Property Summary

NCBI Gene PubMed Count 13
Grant Count 2
Funding $239,021.8
PubMed Score 5.14
PubTator Score 4.65

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (1)

Disease log2 FC p
diabetes mellitus 2.100 0.001

Synonym

Accession Q6JQN1 G3XAJ0 Q8N828 Q8NAP2 Q96BX5 ACAD-10
Symbols

Gene

PANTHER Protein Class (2)

 Grant Application (2)

Gene RIF (7)

PMID Text
21237683 ACAD10 has significant activity towards the branched-chain substrates R and S, 2 methyl-C15-CoA and is highly expressed in fetal but not adult brain
20877624 Observational study of gene-disease association. (HuGE Navigator)
20390405 Results propose that ACAD10 variation may increase type 2 diabetes susceptibility by impairing insulin sensitivity via abnormal lipid oxidation.
20390405 Observational study of gene-disease association. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
18950845 Observational study of gene-disease association. (HuGE Navigator)
15560374 cDNA ACAD10 maps to chromosome 12q24.1

AA Sequence

MCVRSCFQSPRLQWVWRTAFLKHTQRRHQGSHRWTHLGGSTYRAVIFDMGGVLIPSPGRVAAEWEVQNRI      1 - 70
PSGTILKALMEGGENGPWMRFMRAEITAEGFLREFGRLCSEMLKTSVPVDSFFSLLTSERVAKQFPVMTE     71 - 140
AITQIRAKGLQTAVLSNNFYLPNQKSFLPLDRKQFDVIVESCMEGICKPDPRIYKLCLEQLGLQPSESIF    141 - 210
LDDLGTNLKEAARLGIHTIKVNDPETAVKELEALLGFTLRVGVPNTRPVKKTMEIPKDSLQKYLKDLLGI    211 - 280
QTTGPLELLQFDHGQSNPTYYIRLANRDLVLRKKPPGTLLPSAHAIEREFRIMKALANAGVPVPNVLDLC    281 - 350
EDSSVIGTPFYVMEYCPGLIYKDPSLPGLEPSHRRAIYTAMNTVLCKIHSVDLQAVGLEDYGKQGDYIPR    351 - 420
QVRTWVKQYRASETSTIPAMERLIEWLPLHLPRQQRTTVVHGDFRLDNLVFHPEEPEVLAVLDWELSTLG    421 - 490
DPLADVAYSCLAHYLPSSFPVLRGINDCDLTQLGIPAAEEYFRMYCLQMGLPPTENWNFYMAFSFFRVAA    491 - 560
ILQGVYKRSLTGQASSTYAEQTGKLTEFVSNLAWDFAVKEGFRVFKEMPFTNPLTRSYHTWARPQSQWCP    561 - 630
TGSRSYSSVPEASPAHTSRGGLVISPESLSPPVRELYHRLKHFMEQRVYPAEPELQSHQASAARWSPSPL    631 - 700
IEDLKEKAKAEGLWNLFLPLEADPEKKYGAGLTNVEYAHLCELMGTSLYAPEVCNCSAPDTGNMELLVRY    701 - 770
GTEAQKARWLIPLLEGKARSCFAMTEPQVASSDATNIEASIREEDSFYVINGHKWWITGILDPRCQLCVF    771 - 840
MGKTDPHAPRHRQQSVLLVPMDTPGIKIIRPLTVYGLEDAPGGHGEVRFEHVRVPKENMVLGPGRGFEIA    841 - 910
QGRLGPGRIHHCMRLIGFSERALALMKARVKSRLAFGKPLVEQGTVLADIAQSRVEIEQARLLVLRAAHL    911 - 980
MDLAGNKAAALDIAMIKMVAPSMASRVIDRAIQAFGAAGLSSDYPLAQFFTWARALRFADGPDEVHRATV    981 - 1050
AKLELKHRI                                                                1051 - 1059
//

Text Mined References (17)

PMID Year Title
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23364394 2013 A genome-wide association study of a coronary artery disease risk variant.
22423221 2012 A meta-analysis and genome-wide association study of platelet count and mean platelet volume in african americans.
21642993 2011 Genome-wide association study identifies three new susceptibility loci for esophageal squamous-cell carcinoma in Chinese populations.
21237683 2011 Identification and characterization of new long chain acyl-CoA dehydrogenases.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
20390405 2010 Variants in ACAD10 are associated with type 2 diabetes, insulin resistance and lipid oxidation in Pima Indians.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
18950845 2009 Evaluating new candidate SNPs as low penetrance risk factors in sporadic breast cancer: a two-stage Spanish case-control study.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
More...