Property Summary

NCBI Gene PubMed Count 9
PubMed Score 4.52
PubTator Score 5.87

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count Z-score Confidence
SPERMATOGENIC FAILURE 11 1 0.0 0.0
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6
Disease Target Count Z-score Confidence
Male infertility 206 4.101 2.1
Infertility 188 3.286 1.6

Expression

Gene RIF (2)

AA Sequence

MEMESAAASTRFHQPHMERKMSAMACEIFNELRLEGKLCDVVIKVNGFEFSAHKNILCSCSSYFRALFTS      1 - 70
GWNNTEKKVYNIPGISPDMMKLIIEYAYTRTVPITPDNVEKLLAAADQFNIMGIVRGCCEFLKSELCLDN     71 - 140
CIGICKFTDYYYCPELRQKAYMFILHNFEEMVKVSAEFLELSVTELKDIIEKDELNVKQEDAVFEAILKW    141 - 210
ISHDPQNRKQHISILLPKVRLALMHAEYFMNNVKMNDYVKDSEECKPVIINALKAMYDLNMNGPSNSDFT    211 - 280
NPLTRPRLPYAILFAIGGWSGGSPTNAIEAYDARADRWVNVTCEEESPRAYHGAAYLKGYVYIIGGFDSV    281 - 350
DYFNSVKRFDPVKKTWHQVAPMHSRRCYVSVTVLGNFIYAMGGFDGYVRLNTAERYEPETNQWTLIAPMH    351 - 420
EQRSDASATTLYGKVYICGGFNGNECLFTAEVYNTESNQWTVIAPMRSRRSGIGVIAYGEHVYAVGGFDG    421 - 490
ANRLRSAEAYSPVANTWRTIPTMFNPRSNFGIEVVDDLLFVVGGFNGFTTTFNVECYDEKTDEWYDAHDM    491 - 560
SIYRSALSCCVVPGLANVEEYAARRDNFPGLALRDEVKYSASTSTLPV                          561 - 608
//

Text Mined References (9)

PMID Year Title