Property Summary

NCBI Gene PubMed Count 9
PubMed Score 4.48
PubTator Score 5.87

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q6JEL2 Q6NW28 Q96MC0
Symbols SPGF11

Gene

  Ortholog (12)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Horse OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid
Platypus OMA EggNOG
Chicken OMA EggNOG Inparanoid
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG

Gene RIF (2)

PMID Text
20218307 The KLHL-10 gene is not a major contributor to azoospermia, oligospermia or asthenospermia in Chinese population.
20218307 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MEMESAAASTRFHQPHMERKMSAMACEIFNELRLEGKLCDVVIKVNGFEFSAHKNILCSCSSYFRALFTS      1 - 70
GWNNTEKKVYNIPGISPDMMKLIIEYAYTRTVPITPDNVEKLLAAADQFNIMGIVRGCCEFLKSELCLDN     71 - 140
CIGICKFTDYYYCPELRQKAYMFILHNFEEMVKVSAEFLELSVTELKDIIEKDELNVKQEDAVFEAILKW    141 - 210
ISHDPQNRKQHISILLPKVRLALMHAEYFMNNVKMNDYVKDSEECKPVIINALKAMYDLNMNGPSNSDFT    211 - 280
NPLTRPRLPYAILFAIGGWSGGSPTNAIEAYDARADRWVNVTCEEESPRAYHGAAYLKGYVYIIGGFDSV    281 - 350
DYFNSVKRFDPVKKTWHQVAPMHSRRCYVSVTVLGNFIYAMGGFDGYVRLNTAERYEPETNQWTLIAPMH    351 - 420
EQRSDASATTLYGKVYICGGFNGNECLFTAEVYNTESNQWTVIAPMRSRRSGIGVIAYGEHVYAVGGFDG    421 - 490
ANRLRSAEAYSPVANTWRTIPTMFNPRSNFGIEVVDDLLFVVGGFNGFTTTFNVECYDEKTDEWYDAHDM    491 - 560
SIYRSALSCCVVPGLANVEEYAARRDNFPGLALRDEVKYSASTSTLPV                          561 - 608
//

Text Mined References (9)

PMID Year Title
23676014 2013 Update on the Kelch-like (KLHL) gene family.
20218307 2009 [Mutation of KLHL-10 in idiopathic infertile males with azoospermia, oligospermia or asthenospermia].
17047026 2006 Non-invasive genetic diagnosis of male infertility using spermatozoal RNA: KLHL10 mutations in oligozoospermic patients impair homodimerization.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15342556 2004 Sequence comparison of human and mouse genes reveals a homologous block structure in the promoter regions.
15136734 2004 Haploinsufficiency of kelch-like protein homolog 10 causes infertility in male mice.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.