Property Summary

NCBI Gene PubMed Count 9
Grant Count 5
R01 Count 5
Funding $483,027.34
PubMed Score 4.48
PubTator Score 5.87

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (3)

Expression

Gene RIF (2)

PMID Text
20218307 The KLHL-10 gene is not a major contributor to azoospermia, oligospermia or asthenospermia in Chinese population.
20218307 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MEMESAAASTRFHQPHMERKMSAMACEIFNELRLEGKLCDVVIKVNGFEFSAHKNILCSCSSYFRALFTS      1 - 70
GWNNTEKKVYNIPGISPDMMKLIIEYAYTRTVPITPDNVEKLLAAADQFNIMGIVRGCCEFLKSELCLDN     71 - 140
CIGICKFTDYYYCPELRQKAYMFILHNFEEMVKVSAEFLELSVTELKDIIEKDELNVKQEDAVFEAILKW    141 - 210
ISHDPQNRKQHISILLPKVRLALMHAEYFMNNVKMNDYVKDSEECKPVIINALKAMYDLNMNGPSNSDFT    211 - 280
NPLTRPRLPYAILFAIGGWSGGSPTNAIEAYDARADRWVNVTCEEESPRAYHGAAYLKGYVYIIGGFDSV    281 - 350
DYFNSVKRFDPVKKTWHQVAPMHSRRCYVSVTVLGNFIYAMGGFDGYVRLNTAERYEPETNQWTLIAPMH    351 - 420
EQRSDASATTLYGKVYICGGFNGNECLFTAEVYNTESNQWTVIAPMRSRRSGIGVIAYGEHVYAVGGFDG    421 - 490
ANRLRSAEAYSPVANTWRTIPTMFNPRSNFGIEVVDDLLFVVGGFNGFTTTFNVECYDEKTDEWYDAHDM    491 - 560
SIYRSALSCCVVPGLANVEEYAARRDNFPGLALRDEVKYSASTSTLPV                          561 - 608
//

Text Mined References (9)

PMID Year Title
23676014 2013 Update on the Kelch-like (KLHL) gene family.
20218307 2009 [Mutation of KLHL-10 in idiopathic infertile males with azoospermia, oligospermia or asthenospermia].
17047026 2006 Non-invasive genetic diagnosis of male infertility using spermatozoal RNA: KLHL10 mutations in oligozoospermic patients impair homodimerization.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15342556 2004 Sequence comparison of human and mouse genes reveals a homologous block structure in the promoter regions.
15136734 2004 Haploinsufficiency of kelch-like protein homolog 10 causes infertility in male mice.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.