Property Summary

NCBI Gene PubMed Count 6
Grant Count 2
R01 Count 2
Funding $57,760
PubMed Score 6.97
PubTator Score 3.99

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
osteosarcoma -3.275 0.000
glioblastoma 1.200 0.012
periodontitis 1.100 0.000
adrenocortical carcinoma -1.070 0.005
tuberculosis 1.200 0.000
non-small cell lung cancer -1.726 0.000
interstitial cystitis 1.200 0.027
pediatric high grade glioma 1.200 0.002
pilocytic astrocytoma 1.700 0.000
primary Sjogren syndrome 2.300 0.000
subependymal giant cell astrocytoma 1.492 0.031
invasive ductal carcinoma 1.097 0.006
Breast cancer -1.900 0.000
ulcerative colitis 1.900 0.004
ovarian cancer -1.200 0.000

Gene RIF (4)

PMID Text
19536175 Observational study of gene-disease association. (HuGE Navigator)
19064610 Observational study of gene-disease association. (HuGE Navigator)
17541395 CapZIP is fused to ABL1 in a t(1;9)(q24;q34)-associated B-cell acute lymphoblastic leukemia
15850461 The structure and function of CapZ-interacting protein are reported.

AA Sequence

MEERPAETNANVDNSASPSVAQLAGRFREQAAAAKETPASKPTRRKPPCSLPLFPPKVDLGQNGEEKSPP      1 - 70
NASHPPKFKVKSSPLIEKLQANLTFDPAALLPGASPKSPGLKAMVSPFHSPPSTPSSPGVRSRPSEAEEV     71 - 140
PVSFDQPPEGSHLPCYNKVRTRGSIKRRPPSRRFRRSQSDCGELGDFRAVESSQQNGAKEEDGDEVLPSK    141 - 210
SKAPGSPLSSEGAAGEGVRTLGPAEKPPLRRSPSRTEKQEEDRATEEAKNGEKARRSSEEVDGQHPAQEE    211 - 280
VPESPQTSGPEAENRCGSPREEKPAGEEAEMEKATEVKGERVQNEEVGPEHDSQETKKLEEGAAVKETPH    281 - 350
SPPGGVKGGDVPKQEKGKEKQQEGAVLEPGCSPQTGPAQLETSSEVQSEPAVPKPEDDTPVQDTKM        351 - 416
//

Text Mined References (14)

PMID Year Title
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21269460 2011 Initial characterization of the human central proteome.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19536175 2009 Follow-up of a major linkage peak on chromosome 1 reveals suggestive QTLs associated with essential hypertension: GenNet study.
19369195 2009 Large-scale proteomics analysis of the human kinome.
19367720 2008 Phosphorylation analysis of primary human T lymphocytes using sequential IMAC and titanium oxide enrichment.
19064610 2009 Pre-B-cell leukemia homeobox 1 (PBX1) shows functional and possible genetic association with bone mineral density variation.
17541395 2007 A new partner gene fused to ABL1 in a t(1;9)(q24;q34)-associated B-cell acute lymphoblastic leukemia.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
More...