Property Summary

NCBI Gene PubMed Count 28
PubMed Score 210.66
PubTator Score 133.97

Knowledge Summary

Patent (5,331)

Expression

  Differential Expression (27)

Disease log2 FC p
adult high grade glioma -3.900 9.4e-04
astrocytic glioma -3.400 4.9e-03
Astrocytoma, Pilocytic -4.100 8.7e-07
Atopic dermatitis 1.100 2.7e-03
atypical teratoid / rhabdoid tumor -4.900 1.2e-08
colon cancer -1.400 3.9e-02
ependymoma -3.700 7.7e-03
facioscapulohumeral dystrophy -1.600 4.5e-02
fibroadenoma 1.100 5.8e-03
gastric cancer 2.000 7.7e-04
glioblastoma -3.600 1.7e-07
group 3 medulloblastoma -3.900 9.7e-03
interstitial cystitis -1.600 3.7e-03
intraductal papillary-mucinous adenoma (... 4.900 9.4e-05
intraductal papillary-mucinous carcinoma... 4.000 1.7e-03
lung adenocarcinoma 1.200 7.0e-13
malignant mesothelioma 2.200 6.3e-08
medulloblastoma, large-cell -5.200 1.1e-03
non-small cell lung cancer 1.223 4.8e-10
oligodendroglioma -3.200 1.1e-02
osteosarcoma -3.936 5.0e-09
pancreatic cancer 2.500 7.1e-08
Pick disease -1.200 7.2e-04
pituitary cancer -1.900 3.8e-04
primitive neuroectodermal tumor -4.600 1.3e-03
psoriasis 2.300 4.5e-04
spina bifida -2.958 3.4e-02

Gene RIF (20)

AA Sequence

MGMTRMLLECSLSDKLCVIQEKQYEVIIVPTLLVTIFLILLGVILWLFIREQRTQQQRSGPQGIAPVPPP      1 - 70
RDLSWEAGHGGNVALPLKETSVENFLGATTPALAKLQVPREQLSEVLEQICSGSCGPIFRANMNTGDPSK     71 - 140
PKSVILKALKEPAGLHEVQDFLGRIQFHQYLGKHKNLVQLEGCCTEKLPLYMVLEDVAQGDLLSFLWTCR    141 - 210
RDVMTMDGLLYDLTEKQVYHIGKQVLLALEFLQEKHLFHGDVAARNILMQSDLTAKLCGLGLAYEVYTRG    211 - 280
AISSTQTIPLKWLAPERLLLRPASIRADVWSFGILLYEMVTLGAPPYPEVPPTSILEHLQRRKIMKRPSS    281 - 350
CTHTMYSIMKSCWRWREADRPSPRELRLRLEAAIKTADDEAVLQVPELVVPELYAAVAGIRVESLFYNYS    351 - 420
ML                                                                        421 - 422
//

Text Mined References (32)

PMID Year Title