Property Summary

NCBI Gene PubMed Count 24
Grant Count 16
R01 Count 11
Funding $2,424,399
PubMed Score 198.83
PubTator Score 133.97

Knowledge Summary

Patent (5,331)

Expression

  Differential Expression (27)

Disease log2 FC p
gastric cancer 2.000 0.001
malignant mesothelioma 2.200 0.000
astrocytic glioma -3.400 0.005
ependymoma -4.100 0.000
oligodendroglioma -3.200 0.011
psoriasis 2.300 0.000
glioblastoma -4.700 0.000
osteosarcoma -3.936 0.000
medulloblastoma -5.100 0.000
atypical teratoid / rhabdoid tumor -4.900 0.000
medulloblastoma, large-cell -5.200 0.001
primitive neuroectodermal tumor -4.600 0.001
Atopic dermatitis 1.100 0.003
non-small cell lung cancer 1.223 0.000
intraductal papillary-mucinous adenoma (... 4.900 0.000
intraductal papillary-mucinous carcinoma... 4.000 0.002
colon cancer -1.400 0.039
pancreatic cancer 2.500 0.000
fibroadenoma 1.100 0.006
interstitial cystitis -1.600 0.004
lung adenocarcinoma 1.700 0.000
adult high grade glioma -3.900 0.001
pilocytic astrocytoma -4.100 0.000
spina bifida -2.958 0.034
Pick disease -1.200 0.001
pituitary cancer -1.900 0.000
facioscapulohumeral dystrophy -1.600 0.045

Gene RIF (16)

PMID Text
27012048 NOK expression increased in renal cell carcinoma and was significantly correlated with TNM stage, Fuhrman grade, poor overall survival, poor disease-free survival, metastasis, and proliferation.
25961552 The data indicates that both P203 and V395 residues on NOK are important for NOK mediated mitogenic signaling.
25884558 increased STYK1 protein expression correlates with disease progression and metastasis and may serve as a predictor of poor survival in CRC.
25190507 These results suggest that STYK1 is a novel drug resistance factor and could be a predictor of the therapeutic response in acute leukemia.
25169509 STYK1/NOK is dramatically upregulated in colorectal cancer tissues and could be used as a tumor marker. Furthermore, the high expression of STYK1/NOK is significantly associated with tumor size.
24894011 Our results indicate that NOK expression is of clinical significance and can serve as a prognostic biomarker in non-small cell lung cancer.
23010592 The expression levels of NOK, p-Akt(Thr308) and p-GSK-3beta(Ser9) were positively correlated in cancerous and non-cancerous breast cell lines.
22516751 Taken together, NOK has a strong tendency towards forming aggregates, which may have physiological implications and provide the first evidence that this novel receptor kinase is colocalised with EGFR in endosomes to participate in a post-internalisation step of EGFR.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19664042 Overexpression of the potential kinase serine/ threonine/tyrosine kinase 1 (STYK 1) in castration-resistant prostate cancer.
More...

AA Sequence

MGMTRMLLECSLSDKLCVIQEKQYEVIIVPTLLVTIFLILLGVILWLFIREQRTQQQRSGPQGIAPVPPP      1 - 70
RDLSWEAGHGGNVALPLKETSVENFLGATTPALAKLQVPREQLSEVLEQICSGSCGPIFRANMNTGDPSK     71 - 140
PKSVILKALKEPAGLHEVQDFLGRIQFHQYLGKHKNLVQLEGCCTEKLPLYMVLEDVAQGDLLSFLWTCR    141 - 210
RDVMTMDGLLYDLTEKQVYHIGKQVLLALEFLQEKHLFHGDVAARNILMQSDLTAKLCGLGLAYEVYTRG    211 - 280
AISSTQTIPLKWLAPERLLLRPASIRADVWSFGILLYEMVTLGAPPYPEVPPTSILEHLQRRKIMKRPSS    281 - 350
CTHTMYSIMKSCWRWREADRPSPRELRLRLEAAIKTADDEAVLQVPELVVPELYAAVAGIRVESLFYNYS    351 - 420
ML                                                                        421 - 422
//

Text Mined References (28)

PMID Year Title
27012048 2016 High Novel Oncogene with Kinase-Domain (NOK) Gene Expression is Associated with the Progression of Renal Cell Carcinoma.
25961552 2015 NOK mediated mitogenic signaling is altered by P203L and V395I mutations.
25884558 2015 Serine threonine tyrosine kinase 1 is a potential prognostic marker in colorectal cancer.
25190507 2014 Significance of serine threonine tyrosine kinase 1 as a drug resistance factor and therapeutic predictor in acute leukemia.
25169509 2014 Diagnostic relevance of overexpressed serine threonine tyrosine kinase/novel oncogene with kinase domain (STYK1/ NOK) mRNA in colorectal cancer.
24894011 2014 Clinicopathologic features and prognostic implications of NOK/STYK1 protein expression in non-small cell lung cancer.
23010592 2012 NOK/STYK1 interacts with GSK-3? and mediates Ser9 phosphorylation through activated Akt.
22516751 2012 NOK/STYK1 has a strong tendency towards forming aggregates and colocalises with epidermal growth factor receptor in endosomes.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19664042 2009 Overexpression of the potential kinase serine/ threonine/tyrosine kinase 1 (STYK 1) in castration-resistant prostate cancer.
More...