Property Summary

NCBI Gene PubMed Count 11
PubMed Score 19.75
PubTator Score 20.53

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (3)

Expression

  Differential Expression (2)

Disease log2 FC p
aldosterone-producing adenoma -1.142 0.048
lung carcinoma -1.300 0.000

Synonym

Accession Q6J4K2 A6NP50 Q4KMS9 Q6J4K1 Q9H6I8
Symbols NCLX
NCKX6
SLC24A6

Gene

PANTHER Protein Class (2)

Gene RIF (3)

PMID Text
24898248 NCLX, but not LETM1, mediates Ca(2+) extrusion from mitochondria. By controlling the duration of matrix Ca(2+) elevations, NCLX contributes to the regulation of NAD(P)H production and to the conversion of Ca(2+) signals into redox changes.
15060069 NCLX catalyzes active Li(+)/Ca(2+) exchange.
14625281 NCKX6 is a novel member of the Na+/Ca2+ exchanger superfamily

AA Sequence

MAGRRLNLRWALSVLCVLLMAETVSGTRGSSTGAHISPQFPASGVNQTPVVDCRKVCGLNVSDRCDFIRT      1 - 70
NPDCHSDGGYLDYLEGIFCHFPPSLLPLAVTLYVSWLLYLFLILGVTAAKFFCPNLSAISTTLKLSHNVA     71 - 140
GVTFLAFGNGAPDIFSALVAFSDPHTAGLALGALFGAGVLVTTVVAGGITILHPFMAASRPFFRDIVFYM    141 - 210
VAVFLTFLMLFRGRVTLAWALGYLGLYVFYVVTVILCTWIYQRQRRGSLFCPMPVTPEILSDSEEDRVSS    211 - 280
NTNSYDYGDEYRPLFFYQETTAQILVRALNPLDYMKWRRKSAYWKALKVFKLPVEFLLLLTVPVVDPDKD    281 - 350
DQNWKRPLNCLHLVISPLVVVLTLQSGTYGVYEIGGLVPVWVVVVIAGTALASVTFFATSDSQPPRLHWL    351 - 420
FAFLGFLTSALWINAAATEVVNILRSLGVVFRLSNTVLGLTLLAWGNSIGDAFSDFTLARQGYPRMAFSA    421 - 490
CFGGIIFNILVGVGLGCLLQISRSHTEVKLEPDGLLVWVLAGALGLSLVFSLVSVPLQCFQLSRVYGFCL    491 - 560
LLFYLNFLVVALLTEFGVIHLKSM                                                  561 - 584
//

Text Mined References (13)

PMID Year Title
24898248 2014 NCLX protein, but not LETM1, mediates mitochondrial Ca2+ extrusion, thereby limiting Ca2+-induced NAD(P)H production and modulating matrix redox state.
23538132 2013 NCLX: the mitochondrial sodium calcium exchanger.
23506867 The SLC8 gene family of sodium-calcium exchangers (NCX) - structure, function, and regulation in health and disease.
23056385 2012 The mitochondrial Na+/Ca2+ exchanger upregulates glucose dependent Ca2+ signalling linked to insulin secretion.
22829870 2012 The mitochondrial Ca2+ uniporter MCU is essential for glucose-induced ATP increases in pancreatic ?-cells.
20018762 2010 NCLX is an essential component of mitochondrial Na+/Ca2+ exchange.
16541075 2006 The finished DNA sequence of human chromosome 12.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15060069 2004 Lithium-calcium exchange is mediated by a distinct potassium-independent sodium-calcium exchanger.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
More...