Property Summary

NCBI Gene PubMed Count 13
PubMed Score 33.90
PubTator Score 20.53

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
lung carcinoma 2843 2.3e-24
aldosterone-producing adenoma 665 4.8e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.7
Disease Target Count Z-score Confidence
Swine influenza 8 3.567 1.8

Expression

  Differential Expression (2)

Disease log2 FC p
aldosterone-producing adenoma -1.142 4.8e-02
lung carcinoma -1.300 2.3e-24

 CSPA Cell Line (2)

Gene RIF (5)

AA Sequence

MAGRRLNLRWALSVLCVLLMAETVSGTRGSSTGAHISPQFPASGVNQTPVVDCRKVCGLNVSDRCDFIRT      1 - 70
NPDCHSDGGYLDYLEGIFCHFPPSLLPLAVTLYVSWLLYLFLILGVTAAKFFCPNLSAISTTLKLSHNVA     71 - 140
GVTFLAFGNGAPDIFSALVAFSDPHTAGLALGALFGAGVLVTTVVAGGITILHPFMAASRPFFRDIVFYM    141 - 210
VAVFLTFLMLFRGRVTLAWALGYLGLYVFYVVTVILCTWIYQRQRRGSLFCPMPVTPEILSDSEEDRVSS    211 - 280
NTNSYDYGDEYRPLFFYQETTAQILVRALNPLDYMKWRRKSAYWKALKVFKLPVEFLLLLTVPVVDPDKD    281 - 350
DQNWKRPLNCLHLVISPLVVVLTLQSGTYGVYEIGGLVPVWVVVVIAGTALASVTFFATSDSQPPRLHWL    351 - 420
FAFLGFLTSALWINAAATEVVNILRSLGVVFRLSNTVLGLTLLAWGNSIGDAFSDFTLARQGYPRMAFSA    421 - 490
CFGGIIFNILVGVGLGCLLQISRSHTEVKLEPDGLLVWVLAGALGLSLVFSLVSVPLQCFQLSRVYGFCL    491 - 560
LLFYLNFLVVALLTEFGVIHLKSM                                                  561 - 584
//

Text Mined References (16)

PMID Year Title