Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
ovarian cancer 8492 3.72741593204659E-10
osteosarcoma 7933 3.98531156429786E-9
non diabetic and post-ischemic heart failure 200 0.00170432740235413
type II diabetes mellitus and post-ischemic heart failure 89 0.0149540744282377
oligodendroglioma 2849 0.027113600187973
acute myeloid leukemia 785 0.0458142402976143

Expression

  Differential Expression (6)

Synonym

Accession Q6J272 A6NND9 Q8N830
Symbols HSD46

Gene

  Ortholog (9)

AA Sequence

MTTTQKHDLFTPEPHYVPGYAGFFPQLRYQVGNTYGRTTGQLLTDPSVQKSPCSVLSPMSKPKFIEDFSQ      1 - 70
SKPPRVPCQDLTEPYIPHYTSLKPSKNFEILGQLPPLEVDAQEPPGVENIPRQILLPAGFTPDTPHPPCP     71 - 140
PGRKGDSRDLGHPVYGEEAWKSATPVCEAPRQHQLYHCQRDEYPPPARRQQETLDVGSFQRLPQLDHPNL    141 - 210
IQRKAISGYAGFIPRFTWVMGLNYRDGVMQAMDEFDKSQFLFRNPHCDLGEKLPGTHWPSNHIYSSQGLI    211 - 280
PFYMGFIPAMQDNYALTFGNSTRRAYWKEWAKRNHTL                                     281 - 317
//

Text Mined References (5)

PMID Year Title
21630459 2011 Proteomic characterization of the human sperm nucleus.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15164053 2004 DNA sequence and analysis of human chromosome 9.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.