Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.00

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
acute myeloid leukemia 1.400 4.6e-02
non diabetic and post-ischemic heart fai... -1.500 1.7e-03
oligodendroglioma -1.300 2.7e-02
osteosarcoma 1.228 6.2e-07
ovarian cancer 1.100 3.7e-10
type II diabetes mellitus and post-ische... -1.300 1.5e-02

AA Sequence

MTTTQKHDLFTPEPHYVPGYAGFFPQLRYQVGNTYGRTTGQLLTDPSVQKSPCSVLSPMSKPKFIEDFSQ      1 - 70
SKPPRVPCQDLTEPYIPHYTSLKPSKNFEILGQLPPLEVDAQEPPGVENIPRQILLPAGFTPDTPHPPCP     71 - 140
PGRKGDSRDLGHPVYGEEAWKSATPVCEAPRQHQLYHCQRDEYPPPARRQQETLDVGSFQRLPQLDHPNL    141 - 210
IQRKAISGYAGFIPRFTWVMGLNYRDGVMQAMDEFDKSQFLFRNPHCDLGEKLPGTHWPSNHIYSSQGLI    211 - 280
PFYMGFIPAMQDNYALTFGNSTRRAYWKEWAKRNHTL                                     281 - 317
//

Text Mined References (5)

PMID Year Title