Property Summary

NCBI Gene PubMed Count 16
Grant Count 8
Funding $1,263,461.52
PubMed Score 10.70
PubTator Score 16.30

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
Prostate cancer 172 3.229 1.6

Expression

Synonym

Accession Q6IWH7 Q6IWH6
Symbols NGEP
DTMPP
IPCA5
D-TMPP
IPCA-5
PCANAP5
TMEM16G
PCANAP5L

Gene

Gene RIF (7)

PMID Text
25808443 high level of NGEP expression could be associated with good prognosis in prostate cancer
23955683 NGEP protein is widely expressed in low-grade to high-grade prostate adenocarcinomas as well as benign prostate tissues, and the intensity of expression is inversely proportional to the level of malignancy.
19495750 NGEP is a potential target for T cell-mediated immunotherapy of prostate cancer.
18676855 NGEP is a glycoprotein with predicted glycosylation sites at N809 and N824. When these residues were converted to glutamine, glycosylation was abolished, confirming that the residues are extracellular
15761874 description of the novel prostate-restricted molecule D-TMPP widely expressed in prostate cancer tissues
15375614 Complete coding sequence of TMEM16G cDNA was determined by assembling 25 exons of TMEM16G gene
14981236 expressed only in prostate and prostate camcer is a promising target for the antibody-based therapies of prostate cancer

AA Sequence

MRMAATAWAGLQGPPLPTLCPAVRTGLYCRDQAHAERWAMTSETSSGSHCARSRMLRRRAQEEDSTVLID      1 - 70
VSPPEAEKRGSYGSTAHASEPGGQQAAACRAGSPAKPRIADFVLVWEEDLKLDRQQDSAARDRTDMHRTW     71 - 140
RETFLDNLRAAGLCVDQQDVQDGNTTVHYALLSASWAVLCYYAEDLRLKLPLQELPNQASNWSAGLLAWL    141 - 210
GIPNVLLEVVPDVPPEYYSCRFRVNKLPRFLGSDNQDTFFTSTKRHQILFEILAKTPYGHEKKNLLGIHQ    211 - 280
LLAEGVLSAAFPLHDGPFKTPPEGPQAPRLNQRQVLFQHWARWGKWNKYQPLDHVRRYFGEKVALYFAWL    281 - 350
GFYTGWLLPAAVVGTLVFLVGCFLVFSDIPTQELCGSKDSFEMCPLCLDCPFWLLSSACALAQAGRLFDH    351 - 420
GGTVFFSLFMALWAVLLLEYWKRKSATLAYRWDCSDYEDTEERPRPQFAASAPMTAPNPITGEDEPYFPE    421 - 490
RSRARRMLAGSVVIVVMVAVVVMCLVSIILYRAIMAIVVSRSGNTLLAAWASRIASLTGSVVNLVFILIL    491 - 560
SKIYVSLAHVLTRWEMHRTQTKFEDAFTLKVFIFQFVNFYSSPVYIAFFKGRFVGYPGNYHTLFGVRNEE    561 - 630
CAAGGCLIELAQELLVIMVGKQVINNMQEVLIPKLKGWWQKFRLRSKKRKAGASAGASQGPWEDDYELVP    631 - 700
CEGLFDEYLEMVLQFGFVTIFVAACPLAPLFALLNNWVEIRLDARKFVCEYRRPVAERAQDIGIWFHILA    701 - 770
GLTHLAVISNAFLLAFSSDFLPRAYYRWTRAHDLRGFLNFTLARAPSSFAAAHNRTCRYRAFRDDDGHYS    771 - 840
QTYWNLLAIRLAFVIVFEHVVFSVGRLLDLLVPDIPESVEIKVKREYYLAKQALAENEVLFGTNGTKDEQ    841 - 910
PEGSELSSHWTPFTVPKASQLQQ                                                   911 - 933
//

Text Mined References (22)

PMID Year Title
25808443 2015 Study of NGEP expression pattern in cancerous tissues provides novel insights into prognostic marker in prostate cancer.
24692353 2014 Structure and function of TMEM16 proteins (anoctamins).
23955683 2013 Reduced expression of NGEP is associated with high-grade prostate cancers: a tissue microarray analysis.
23535732 2013 Identification of 23 new prostate cancer susceptibility loci using the iCOGS custom genotyping array.
22946059 2012 Anoctamins are a family of Ca2+-activated Cl- channels.
22302790 2012 The anoctamin (TMEM16) gene family: calcium-activated chloride channels come of age.
22075693 2012 ANOs 3-7 in the anoctamin/Tmem16 Cl- channel family are intracellular proteins.
21984732 2012 The anoctamin family: TMEM16A and TMEM16B as calcium-activated chloride channels.
21642943 2011 Physiological roles and diseases of Tmem16/Anoctamin proteins: are they all chloride channels?
21607626 2011 Anoctamins.
More...