Property Summary

NCBI Gene PubMed Count 18
PubMed Score 11.39
PubTator Score 13.94

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
psoriasis 6694 1.8e-03
diabetes mellitus 1728 2.1e-03
tuberculosis 2010 1.7e-02
colon cancer 1478 1.9e-02
active ulcerative colitis 764 2.4e-02

Expression

  Differential Expression (5)

Disease log2 FC p
active ulcerative colitis 1.634 2.4e-02
colon cancer 1.500 1.9e-02
diabetes mellitus 1.400 2.1e-03
psoriasis 1.300 1.8e-03
tuberculosis 1.300 1.7e-02

Gene RIF (9)

AA Sequence

MSPHLTALLGLVLCLAQTIHTQEGALPRPSISAEPGTVISPGSHVTFMCRGPVGVQTFRLEREDRAKYKD      1 - 70
SYNVFRLGPSESEARFHIDSVSEGNAGLYRCLYYKPPGWSEHSDFLELLVKESSGGPDSPDTEPGSSAGT     71 - 140
VPGTEASGFDAP                                                              141 - 152
//

Text Mined References (18)

PMID Year Title