Property Summary

NCBI Gene PubMed Count 18
PubMed Score 11.19
PubTator Score 13.94

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
psoriasis 2.700 0.000
tuberculosis 1.300 0.017
colon cancer 1.500 0.019
active ulcerative colitis 1.634 0.024
diabetes mellitus 1.400 0.002

Gene RIF (9)

PMID Text
26721477 We suggest that LAIR1 and LAIR2 genetic variants are associated with regulation of gene expression and variable pemphigus foliaceus susceptibility, and show indirect association of LAIR2 differential mRNA expression with pemphigus foliaceus pathogenesis.
24192271 recombinant LAIR-2-Fc inhibits complement-mediated lysis of cells sensitized with anti-HLA antibodies
23691008 the presence of high LAIR-2 levels in 74/80 sera from patients with autoimmune thyroid diseases
23332415 LAIR2-expressing extravillous trophoblasts associate with maternal spiral arterioles undergoing physiologic conversion
22294640 Two markers in two different genes (CNOT3 and LAIR2) showed significant association with ankylosing spondylitis.
20730098 LAIR-2/Fc has the capacity to interfere with platelet-collagen interactions mediated by Glycoprotein VI and the VWF/Glycoprotein Ib axis.
20237496 Observational study of gene-disease association. (HuGE Navigator)
19345263 Human collagen II peptides II-17, -27, -30, -35, -38, -42, -49 & -56; and collagen III peptides III-1, 5, -8, -10, -12, -13, -22, -30, -38, -40, -44, -45, and -51 specifically interacted with hLAIR-2 expressed on K562 cells
18209062 LAIR-2 prevents binding of human LAIR-1 to collagens and LAIR-1 cross-linking in vitro, suggesting that the protein has an immunoregulatory function in vivo.

AA Sequence

MSPHLTALLGLVLCLAQTIHTQEGALPRPSISAEPGTVISPGSHVTFMCRGPVGVQTFRLEREDRAKYKD      1 - 70
SYNVFRLGPSESEARFHIDSVSEGNAGLYRCLYYKPPGWSEHSDFLELLVKESSGGPDSPDTEPGSSAGT     71 - 140
VPGTEASGFDAP                                                              141 - 152
//

Text Mined References (18)

PMID Year Title
26721477 2016 Differential gene expression levels might explain association of LAIR2 polymorphisms with pemphigus.
25416956 2014 A proteome-scale map of the human interactome network.
24192271 2014 Inhibition of the classical and lectin pathway of the complement system by recombinant LAIR-2.
23691008 2013 Serum LAIR-2 is increased in autoimmune thyroid diseases.
23332415 2013 LAIR2-expressing extravillous trophoblasts associate with maternal spiral arterioles undergoing physiologic conversion.
22294640 2012 A high density SNP genotyping approach within the 19q13 chromosome region identifies an association of a CNOT3 polymorphism with ankylosing spondylitis.
20730098 2010 Efficient inhibition of collagen-induced platelet activation and adhesion by LAIR-2, a soluble Ig-like receptor family member.
20237496 2010 New genetic associations detected in a host response study to hepatitis B vaccine.
19345263 2009 Identification of multiple potent binding sites for human leukocyte associated Ig-like receptor LAIR on collagens II and III.
18209062 2008 The soluble leukocyte-associated Ig-like receptor (LAIR)-2 antagonizes the collagen/LAIR-1 inhibitory immune interaction.
More...