Property Summary

NCBI Gene PubMed Count 53
PubMed Score 142.68
PubTator Score 37.79

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (8)

Disease log2 FC p
ductal carcinoma in situ 1.300 2.0e-03
interstitial cystitis -1.400 3.3e-03
invasive ductal carcinoma 1.600 6.0e-03
lung cancer 1.500 1.1e-02
non-small cell lung cancer 1.329 2.2e-12
ovarian cancer 1.700 7.8e-11
psoriasis -2.200 2.8e-04
spina bifida -1.050 3.9e-02

Protein-protein Interaction (1)

Gene RIF (41)

AA Sequence

MSQESDNNKRLVALVPMPSDPPFNTRRAYTSEDEAWKSYLENPLTAATKAMMSINGDEDSAAALGLLYDY      1 - 70
YKVPRDKRLLSVSKASDSQEDQEKRNCLGTSEAQSNLSGGENRVQVLKTVPVNLSLNQDHLENSKREQYS     71 - 140
ISFPESSAIIPVSGITVVKAEDFTPVFMAPPVHYPRGDGEEQRVVIFEQTQYDVPSLATHSAYLKDDQRS    141 - 210
TPDSTYSESFKDAATEKFRSASVGAEEYMYDQTSSGTFQYTLEATKSLRQKQGEGPMTYLNKGQFYAITL    211 - 280
SETGDNKCFRHPISKVRSVVMVVFSEDKNRDEQLKYWKYWHSRQHTAKQRVLDIADYKESFNTIGNIEEI    281 - 350
AYNAVSFTWDVNEEAKIFITVNCLSTDFSSQKGVKGLPLMIQIDTYSYNNRSNKPIHRAYCQIKVFCDKG    351 - 420
AERKIRDEERKQNRKKGKGQASQTQCNSSSDGKLAAIPLQKKSDITYFKTMPDLHSQPVLFIPDVHFANL    421 - 490
QRTGQVYYNTDDEREGGSVLVKRMFRPMEEEFGPVPSKQMKEEGTKRVLLYVRKETDDVFDALMLKSPTV    491 - 560
KGLMEAISEKYGLPVEKIAKLYKKSKKGILVNMDDNIIEHYSNEDTFILNMESMVEGFKVTLMEI         561 - 625
//

Text Mined References (52)

PMID Year Title