Property Summary

NCBI Gene PubMed Count 36
Grant Count 14
R01 Count 1
Funding $1,274,734.35
PubMed Score 132.29
PubTator Score 37.79

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
psoriasis -2.200 0.000
non-small cell lung cancer 1.329 0.000
lung cancer 1.500 0.011
interstitial cystitis -2.300 0.000
spina bifida -1.050 0.039
ductal carcinoma in situ 1.300 0.002
invasive ductal carcinoma 1.600 0.006
ovarian cancer 1.700 0.000

Gene RIF (24)

PMID Text
26826389 Taken together, our results demonstrate a role for miR-217 in the regulation of keratinocyte differentiation, partially through the regulation of GRHL2.
26400775 Genetic variations in the EYA4, GRHL2 and DFNA5 genes and their interactions with occupational noise exposure may play an important role in the incidence of noise-induced hearing loss (NIHL).
26085095 The p63 gene is regulated by GRHL2 through reciprocal feedback and determines the epithelial phenotype in human keratinocytes.
26069269 GRHL1, GRHL2, and GRHL3 have roles in cellular proliferation, differentiation, adhesion, and polarity and may promote cancer or be tumor suppressors [review]
25758223 A Grhl2-dependent gene network controls trophoblast branching morphogenesis.
25152456 Mutations in GRHL2 result in an autosomal-recessive ectodermal Dysplasia syndrome.
24756066 has identified ZEB1 as a target of GRHL2 and suggested a reciprocal GRHL2-ZEB1 repressive relationship, providing a novel mechanism through which proliferation may be modulated in colorectal cancer cells.
24131873 These findings indicate that GRHL2 may be a noise-induced hearing loss susceptibility gene and that polymorphisms of GRLH2 may contribute to the etiology of noise-induced hearing loss.
24068586 Over-expression of Grhl2 decreased c-Myc and Bcl-2 protein expression level.
23814079 expression of GRHL2 is directly suppressed by the ZEB1, which in turn is a direct target for repression by GRHL2, suggesting that the EMT transcription factors GRHL2 and ZEB1 form a double negative regulatory feedback loop
More...

AA Sequence

MSQESDNNKRLVALVPMPSDPPFNTRRAYTSEDEAWKSYLENPLTAATKAMMSINGDEDSAAALGLLYDY      1 - 70
YKVPRDKRLLSVSKASDSQEDQEKRNCLGTSEAQSNLSGGENRVQVLKTVPVNLSLNQDHLENSKREQYS     71 - 140
ISFPESSAIIPVSGITVVKAEDFTPVFMAPPVHYPRGDGEEQRVVIFEQTQYDVPSLATHSAYLKDDQRS    141 - 210
TPDSTYSESFKDAATEKFRSASVGAEEYMYDQTSSGTFQYTLEATKSLRQKQGEGPMTYLNKGQFYAITL    211 - 280
SETGDNKCFRHPISKVRSVVMVVFSEDKNRDEQLKYWKYWHSRQHTAKQRVLDIADYKESFNTIGNIEEI    281 - 350
AYNAVSFTWDVNEEAKIFITVNCLSTDFSSQKGVKGLPLMIQIDTYSYNNRSNKPIHRAYCQIKVFCDKG    351 - 420
AERKIRDEERKQNRKKGKGQASQTQCNSSSDGKLAAIPLQKKSDITYFKTMPDLHSQPVLFIPDVHFANL    421 - 490
QRTGQVYYNTDDEREGGSVLVKRMFRPMEEEFGPVPSKQMKEEGTKRVLLYVRKETDDVFDALMLKSPTV    491 - 560
KGLMEAISEKYGLPVEKIAKLYKKSKKGILVNMDDNIIEHYSNEDTFILNMESMVEGFKVTLMEI         561 - 625
//

Text Mined References (35)

PMID Year Title
26826389 2016 MiR-217 is down-regulated in psoriasis and promotes keratinocyte differentiation via targeting GRHL2.
26400775 2015 Associations of genetic variations in EYA4, GRHL2 and DFNA5 with noise-induced hearing loss in Chinese population: a case- control study.
26085095 2015 The p63 Gene Is Regulated by Grainyhead-like 2 (GRHL2) through Reciprocal Feedback and Determines the Epithelial Phenotype in Human Keratinocytes.
26069269 2015 Recent discoveries concerning the involvement of transcription factors from the Grainyhead-like family in cancer.
25758223 2015 A Grhl2-dependent gene network controls trophoblast branching morphogenesis.
25416956 2014 A proteome-scale map of the human interactome network.
25152456 2014 Mutations in GRHL2 result in an autosomal-recessive ectodermal Dysplasia syndrome.
24756066 2014 Downregulation of GRHL2 inhibits the proliferation of colorectal cancer cells by targeting ZEB1.
24390342 2014 Genetics of rheumatoid arthritis contributes to biology and drug discovery.
24131873 2013 Association between genetic variations in GRHL2 and noise-induced hearing loss in Chinese high intensity noise exposed workers: a case-control analysis.
More...