Property Summary

NCBI Gene PubMed Count 13
PubMed Score 1.00
PubTator Score 1.00

Knowledge Summary

Patent

No data available

Expression

AA Sequence

MADDLDFETGDAGASATFPMQCSALRKNGFVVLKGWPCKIVEMSASKTGKHGHAKVHLVGIDIFTGKKYE      1 - 70
DICPSTHNMDVPNIKRNDFQLIGIQDGYLSLLQDSGEVPEDLRLPEGDLGKEIEQKYDCGEEILITVLSA     71 - 140
MTEEAAVAIKAMAK                                                            141 - 154
//

Text Mined References (13)

PMID Year Title
16916647 2006 Substrate and functional diversity of lysine acetylation revealed by a proteomics survey.
16519677 2006 Differential expression of eIF5A-1 and eIF5A-2 in human cancer cells.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11742107 2001 Homology modelling of the human eukaryotic initiation factor 5A (eIF-5A).
10944119 2000 Exportin 4: a mediator of a novel nuclear export pathway in higher eukaryotes.
8253832 1993 Eukaryotic initiation factor 5A is a cellular target of the human immunodeficiency virus type 1 Rev activation domain mediating trans-activation.
7759117 1995 The eukaryotic cofactor for the human immunodeficiency virus type 1 (HIV-1) rev protein, eIF-5A, maps to chromosome 17p12-p13: three eIF-5A pseudogenes map to 10q23.3, 17q25, and 19q13.2.
7622067 1995 Identification of a new member of the human eIF-5A gene family.
7545941 1994 The genomic structure encoding human initiation factor eIF-5A.
More...