Property Summary

NCBI Gene PubMed Count 13
PubMed Score 1.00
PubTator Score 1.00

Knowledge Summary

Patent

No data available

Expression

AA Sequence

MADDLDFETGDAGASATFPMQCSALRKNGFVVLKGWPCKIVEMSASKTGKHGHAKVHLVGIDIFTGKKYE      1 - 70
DICPSTHNMDVPNIKRNDFQLIGIQDGYLSLLQDSGEVPEDLRLPEGDLGKEIEQKYDCGEEILITVLSA     71 - 140
MTEEAAVAIKAMAK                                                            141 - 154
//

Text Mined References (13)

PMID Year Title