Property Summary

NCBI Gene PubMed Count 5
PubMed Score 10.02
PubTator Score 2.00

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
acute myeloid leukemia 1.600 4.7e-03
acute quadriplegic myopathy 1.223 6.7e-05
atypical teratoid / rhabdoid tumor 1.300 4.2e-05
diabetes mellitus -1.100 3.4e-03
ependymoma 1.200 7.4e-09
glioblastoma 1.500 3.5e-05
group 4 medulloblastoma 1.300 1.6e-04
hepatocellular carcinoma -1.100 4.2e-06
juvenile dermatomyositis 1.205 2.3e-11
medulloblastoma, large-cell 1.800 2.8e-06
osteosarcoma 1.059 6.5e-04
primitive neuroectodermal tumor 1.100 3.0e-04
spina bifida -1.709 2.6e-02
tuberculosis and treatment for 6 months 1.200 7.1e-05

Gene RIF (1)

AA Sequence

MAEAAALVWIRGPGFGCKAVRCASGRCTVRDFIHRHCQDQNVPVENFFVKCNGALINTSDTVQHGAVYSL      1 - 70
EPRLCGGKGGFGSMLRALGAQIEKTTNREACRDLSGRRLRDVNHEKAMAEWVKQQAEREAEKEQKRLERL     71 - 140
QRKLVEPKHCFTSPDYQQQCHEMAERLEDSVLKGMQAASSKMVSAEISENRKRQWPTKSQTDRGASAGKR    141 - 210
RCFWLGMEGLETAEGSNSESSDDDSEEAPSTSGMGFHAPKIGSNGVEMAAKFPSGSQRARVVNTDHGSPE    211 - 280
QLQIPVTDSGRHILEDSCAELGESKEHMESRMVTETEETQEKKAESKEPIEEEPTGAGLNKDKETEERTD    281 - 350
GERVAEVAPEERENVAVAKLQESQPGNAVIDKETIDLLAFTSVAELELLGLEKLKCELMALGLKCGGTLQ    351 - 420
ERAARLFSVRGLAKEQIDPALFAKPLKGKKK                                           421 - 451
//

Text Mined References (15)

PMID Year Title