Property Summary

NCBI Gene PubMed Count 4
PubMed Score 9.52
PubTator Score 2.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
juvenile dermatomyositis 1189 2.34794414281752E-11
ependymoma 2514 7.4177680667738E-9
medulloblastoma, large-cell 6234 2.82725189362119E-6
hepatocellular carcinoma 550 4.16050608807105E-6
glioblastoma 5572 3.52539530767543E-5
atypical teratoid / rhabdoid tumor 4369 4.16379082903534E-5
acute quadriplegic myopathy 1157 6.73079861037075E-5
tuberculosis and treatment for 6 months 686 7.1490659901168E-5
medulloblastoma 1524 9.33965399576694E-5
primitive neuroectodermal tumor 3031 3.00265858376433E-4
osteosarcoma 7933 6.5199030029517E-4
diabetes mellitus 1663 0.00336315614601951
acute myeloid leukemia 785 0.00467473569231041
spina bifida 1064 0.0262906405614318
Disease Target Count Z-score Confidence
Hydrocephalus 60 3.301 1.7

Expression

  Differential Expression (14)

Disease log2 FC p
hepatocellular carcinoma -1.100 0.000
osteosarcoma 1.059 0.001
ependymoma 1.200 0.000
atypical teratoid / rhabdoid tumor 1.300 0.000
glioblastoma 1.500 0.000
medulloblastoma 1.300 0.000
medulloblastoma, large-cell 1.800 0.000
primitive neuroectodermal tumor 1.100 0.000
juvenile dermatomyositis 1.205 0.000
acute quadriplegic myopathy 1.223 0.000
tuberculosis and treatment for 6 months 1.200 0.000
diabetes mellitus -1.100 0.003
spina bifida -1.709 0.026
acute myeloid leukemia 1.600 0.005

Synonym

Accession Q6IQ49 A8K4P3 Q5TD36 Q6ZS26 Q8NAG7
Symbols C1orf55
dJ671D7.1

Gene

  Ortholog (11)

Species Source
Chimp OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid
Platypus OMA EggNOG Inparanoid
Chicken OMA EggNOG
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG Inparanoid
C. elegans OMA EggNOG

AA Sequence

MAEAAALVWIRGPGFGCKAVRCASGRCTVRDFIHRHCQDQNVPVENFFVKCNGALINTSDTVQHGAVYSL      1 - 70
EPRLCGGKGGFGSMLRALGAQIEKTTNREACRDLSGRRLRDVNHEKAMAEWVKQQAEREAEKEQKRLERL     71 - 140
QRKLVEPKHCFTSPDYQQQCHEMAERLEDSVLKGMQAASSKMVSAEISENRKRQWPTKSQTDRGASAGKR    141 - 210
RCFWLGMEGLETAEGSNSESSDDDSEEAPSTSGMGFHAPKIGSNGVEMAAKFPSGSQRARVVNTDHGSPE    211 - 280
QLQIPVTDSGRHILEDSCAELGESKEHMESRMVTETEETQEKKAESKEPIEEEPTGAGLNKDKETEERTD    281 - 350
GERVAEVAPEERENVAVAKLQESQPGNAVIDKETIDLLAFTSVAELELLGLEKLKCELMALGLKCGGTLQ    351 - 420
ERAARLFSVRGLAKEQIDPALFAKPLKGKKK                                           421 - 451
//

Text Mined References (14)

PMID Year Title
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21333630 2011 Sde2: a novel nuclear protein essential for telomeric silencing and genomic stability in Schizosaccharomyces pombe.
21269460 2011 Initial characterization of the human central proteome.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18220336 2008 Combining protein-based IMAC, peptide-based IMAC, and MudPIT for efficient phosphoproteomic analysis.
17525332 2007 ATM and ATR substrate analysis reveals extensive protein networks responsive to DNA damage.
16712791 2006 Identification of intrahepatic cholangiocarcinoma related genes by comparison with normal liver tissues using expressed sequence tags.
More...