Property Summary

NCBI Gene PubMed Count 6
Grant Count 5
R01 Count 5
Funding $308,200.75
PubMed Score 11.32
PubTator Score 3.15

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
Rheumatoid Arthritis 2.100 0.003
astrocytic glioma -1.600 0.017
atypical teratoid / rhabdoid tumor -2.200 0.000
glioblastoma -2.000 0.001
medulloblastoma -2.000 0.000
medulloblastoma, large-cell -2.600 0.000
primitive neuroectodermal tumor -1.200 0.037

 GO Function (2)

Gene RIF (2)

PMID Text
25925668 a novel signaling pathway identified whereby starvation-induced activation of ULK leads to phosphorylation of endogenous DENND3, with subsequent activation of Rab12 and initiation of membrane trafficking events required for autophagy
24703428 findings demonstrate the functional importance of Rab12 for retrograde toxin trafficking

AA Sequence

MDPGAALQRRAGGGGGLGAGSPALSGGQGRRRKQPPRPADFKLQVIIIGSRGVGKTSLMERFTDDTFCEA      1 - 70
CKSTVGVDFKIKTVELRGKKIRLQIWDTAGQERFNSITSAYYRSAKGIILVYDITKKETFDDLPKWMKMI     71 - 140
DKYASEDAELLLVGNKLDCETDREITRQQGEKFAQQITGMRFCEASAKDNFNVDEIFLKLVDDILKKMPL    141 - 210
DILRNELSNSILSLQPEPEIPPELPPPRPHVRCC                                        211 - 244
//

Text Mined References (14)

PMID Year Title
26824392 2016 Phosphoproteomics reveals that Parkinson's disease kinase LRRK2 regulates a subset of Rab GTPases.
25925668 2015 Phosphorylation of the exchange factor DENND3 by ULK in response to starvation activates Rab12 and induces autophagy.
24703428 2014 Rab12 localizes to Shiga toxin-induced plasma membrane invaginations and controls toxin transport.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22223895 2012 Comparative large scale characterization of plant versus mammal proteins reveals similar and idiosyncratic N-?-acetylation features.
21269460 2011 Initial characterization of the human central proteome.
21194374 2011 Identification and characterisation of novel Mss4-binding Rab GTPases.
20937701 2010 Family-wide characterization of the DENN domain Rab GDP-GTP exchange factors.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
More...