Property Summary

NCBI Gene PubMed Count 16
PubMed Score 82.42
PubTator Score 21.63

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (22)

Disease log2 FC p
adult high grade glioma -1.600 1.3e-03
astrocytic glioma 1.700 1.9e-02
atypical teratoid / rhabdoid tumor -1.900 2.0e-04
ependymoma -1.800 3.5e-02
gastric cancer 1.600 5.3e-03
glioblastoma -2.000 2.6e-05
group 3 medulloblastoma -2.000 1.1e-02
hepatocellular carcinoma 2.000 1.8e-05
intraductal papillary-mucinous adenoma (... 1.900 7.3e-04
intraductal papillary-mucinous carcinoma... 1.400 1.1e-02
intraductal papillary-mucinous neoplasm ... 1.800 1.8e-02
lung carcinoma 1.100 9.2e-10
medulloblastoma, large-cell -3.800 1.2e-06
oligodendroglioma 1.500 1.7e-02
osteosarcoma 1.466 2.7e-04
ovarian cancer -2.200 9.0e-08
pancreatic cancer 1.300 2.3e-02
pancreatic carcinoma 1.300 2.3e-02
primitive neuroectodermal tumor -1.800 5.3e-05
subependymal giant cell astrocytoma -1.707 1.6e-02
tuberculosis and treatment for 6 months -1.300 9.4e-05
ulcerative colitis -1.200 4.1e-03

 GWAS Trait (1)

Gene RIF (10)

AA Sequence

MDENESNQSLMTSSQYPKEAVRKRQNSARNSGASDSSRFSRKSFKLDYRLEEDVTKSKKGKDGRFVNPWP      1 - 70
TWKNPSIPNVLRWLIMEKDHSSVPSSKEELDKELPVLKPYFITNPEEAGVREAGLRVTWLGHATVMVEMD     71 - 140
ELIFLTDPIFSSRASPSQYMGPKRFRRSPCTISELPPIDAVLISHNHYDHLDYNSVIALNERFGNELRWF    141 - 210
VPLGLLDWMQKCGCENVIELDWWEENCVPGHDKVTFVFTPSQHWCKRTLMDDNKVLWGSWSVLGPWNRFF    211 - 280
FAGDTGYCPAFEEIGKRFGPFDLAAIPIGAYEPRWFMKYQHVDPEEAVRIHTDVQTKKSMAIHWGTFALA    281 - 350
NEHYLEPPVKLNEALERYGLNAEDFFVLKHGESRYLNNDDENF                               351 - 393
//

Text Mined References (20)

PMID Year Title