Property Summary

NCBI Gene PubMed Count 16
Grant Count 17
R01 Count 5
Funding $1,194,626.67
PubMed Score 77.22
PubTator Score 21.63

Knowledge Summary

Patent

No data available

Expression

Gene RIF (10)

PMID Text
25684574 NAPE-PLD forms homodimers partly separated by an internal channel and uniquely adapted to associate with phospholipids.
24126189 our results do not support a clear role of FAAH, CNR1 and NAPE-PLD in BD and lithium response.
24018423 a major physiological role of NAPE-PLD
23122699 The differential expression of NAPE-PLD and FAAH suggests that Anandamide could play an important role in the pathophysiology of preeclampsia.
22827915 NAPE-PLD expression increase steadily after infancy, peaking in adulthood.
21251115 The results of this study suggested that NAPEPLD was alterated in multip;e sclerosis.
20885390 a common haplotype in NAPEPLD, an enzyme involved in endocannabinoid synthesis, was protective against obesity.
20885390 Observational study of gene-disease association. (HuGE Navigator)
20369362 During the menstrual cycle, NAPE-PLD immunoreactivity was down-regulated in the secretory epithelial gland compared to the proliferative epithelial gland and unaffected in the stroma.
19715685 The human NAPE-PLD was activated by phosphatidylethanolamine and inhibited by the beta-lactamase substrate nitrocefin.

AA Sequence

MDENESNQSLMTSSQYPKEAVRKRQNSARNSGASDSSRFSRKSFKLDYRLEEDVTKSKKGKDGRFVNPWP      1 - 70
TWKNPSIPNVLRWLIMEKDHSSVPSSKEELDKELPVLKPYFITNPEEAGVREAGLRVTWLGHATVMVEMD     71 - 140
ELIFLTDPIFSSRASPSQYMGPKRFRRSPCTISELPPIDAVLISHNHYDHLDYNSVIALNERFGNELRWF    141 - 210
VPLGLLDWMQKCGCENVIELDWWEENCVPGHDKVTFVFTPSQHWCKRTLMDDNKVLWGSWSVLGPWNRFF    211 - 280
FAGDTGYCPAFEEIGKRFGPFDLAAIPIGAYEPRWFMKYQHVDPEEAVRIHTDVQTKKSMAIHWGTFALA    281 - 350
NEHYLEPPVKLNEALERYGLNAEDFFVLKHGESRYLNNDDENF                               351 - 393
//

Text Mined References (20)

PMID Year Title
25684574 2015 Structure of human N-acylphosphatidylethanolamine-hydrolyzing phospholipase D: regulation of fatty acid ethanolamide biosynthesis by bile acids.
24126189 2013 No association of endocannabinoid genes with bipolar disorder or lithium response in a Sardinian sample.
24018423 2013 Isolevuglandin-modified phosphatidylethanolamine is metabolized by NAPE-hydrolyzing phospholipase D.
23122699 2013 Differential expression of endocannabinoid system in normal and preeclamptic placentas: effects on nitric oxide synthesis.
22827915 2012 Developmental trajectory of the endocannabinoid system in human dorsolateral prefrontal cortex.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
21251115 2011 Cannabinoid receptor and N-acyl phosphatidylethanolamine phospholipase D--evidence for altered expression in multiple sclerosis.
20885390 2011 A common haplotype in NAPEPLD is associated with severe obesity in a Norwegian population-based cohort (the HUNT study).
20369362 2010 Histomorphometric evaluation of cannabinoid receptor and anandamide modulating enzyme expression in the human endometrium through the menstrual cycle.
19715685 2009 Effect of synthetic and natural phospholipids on N-acylphosphatidylethanolamine-hydrolyzing phospholipase D activity.
More...