Property Summary

NCBI Gene PubMed Count 5
PubMed Score 89.53
PubTator Score 20.79

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (18)

Disease log2 FC p
adrenocortical carcinoma 1.050 3.5e-03
adult high grade glioma -1.600 9.8e-03
astrocytic glioma -1.300 2.5e-02
Astrocytoma, Pilocytic -1.200 7.4e-03
Atopic dermatitis -1.100 6.5e-05
atypical teratoid / rhabdoid tumor -1.100 5.5e-03
ependymoma -1.500 2.3e-02
glioblastoma -1.100 1.7e-04
group 4 medulloblastoma -1.100 3.6e-03
intraductal papillary-mucinous carcinoma... 1.100 4.4e-02
lung adenocarcinoma 1.300 4.1e-07
medulloblastoma, large-cell -1.200 2.2e-04
osteosarcoma -1.062 4.3e-06
ovarian cancer 1.300 1.6e-03
Pick disease -1.300 1.4e-03
primitive neuroectodermal tumor -1.100 3.6e-03
subependymal giant cell astrocytoma -2.889 4.9e-03
ulcerative colitis 1.200 1.5e-05

 GO Function (1)

Gene RIF (1)

AA Sequence

MSPGSGVKSEYMKRYQEPRWEEYGPCYRELLHYRLGRRLLEQAHAPWLWDDWGPAGSSEDSASSESSGAG      1 - 70
GPAPRCAPPSPPPPVEPATQEEAERRARGAPEEQDAEAGDAEAEDAEDAALPALPVKDVEDKPEQQTRTR     71 - 140
ETDKSPTSTEPRQQPSALFARGNRKAVKSPQRSSSKIKENKHPFALYGWGEKQTDTGSQKTHNVCASAPV    141 - 210
HEIHESALRAKNRRQVEKRKLVAQRQRAHSVDVEKNRKMKASSSENPWMTEYMRCYSARA              211 - 270
//

Text Mined References (8)

PMID Year Title