Property Summary

NCBI Gene PubMed Count 5
Grant Count 8
R01 Count 5
Funding $5,446,764
PubMed Score 88.53
PubTator Score 20.79

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (18)

Disease log2 FC p
astrocytic glioma -1.300 0.025
ependymoma -1.800 0.000
glioblastoma -1.900 0.000
osteosarcoma -1.062 0.000
atypical teratoid / rhabdoid tumor -2.500 0.000
medulloblastoma -1.200 0.000
medulloblastoma, large-cell -1.200 0.000
primitive neuroectodermal tumor -1.100 0.004
Atopic dermatitis -1.100 0.000
adrenocortical carcinoma 1.050 0.004
intraductal papillary-mucinous carcinoma... 1.100 0.044
pediatric high grade glioma -1.600 0.000
pilocytic astrocytoma -1.200 0.009
subependymal giant cell astrocytoma -2.889 0.005
lung adenocarcinoma 1.300 0.000
Pick disease -1.300 0.001
ulcerative colitis 1.200 0.000
ovarian cancer 1.300 0.002

 GO Function (1)

Gene RIF (1)

PMID Text
26562023 The tubulin binding protein CSAP associates with mitotic microtubules around centrosomes to stabilize mitotic microtubules during mitosis, ensuring proper bipolar spindle formation and maintenance.

AA Sequence

MSPGSGVKSEYMKRYQEPRWEEYGPCYRELLHYRLGRRLLEQAHAPWLWDDWGPAGSSEDSASSESSGAG      1 - 70
GPAPRCAPPSPPPPVEPATQEEAERRARGAPEEQDAEAGDAEAEDAEDAALPALPVKDVEDKPEQQTRTR     71 - 140
ETDKSPTSTEPRQQPSALFARGNRKAVKSPQRSSSKIKENKHPFALYGWGEKQTDTGSQKTHNVCASAPV    141 - 210
HEIHESALRAKNRRQVEKRKLVAQRQRAHSVDVEKNRKMKASSSENPWMTEYMRCYSARA              211 - 270
//

Text Mined References (8)

PMID Year Title
26562023 2015 Polyglutamylated Tubulin Binding Protein C1orf96/CSAP Is Involved in Microtubule Stabilization in Mitotic Spindles.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22493317 2012 CSAP localizes to polyglutamylated microtubules and promotes proper cilia function and zebrafish development.
21399614 2011 Novel asymmetrically localizing components of human centrosomes identified by complementary proteomics methods.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.