Property Summary

NCBI Gene PubMed Count 14
PubMed Score 1.40
PubTator Score 1.02

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
Breast cancer 3578 2.9e-05
medulloblastoma, large-cell 6241 7.6e-05
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.5

Expression

  Differential Expression (2)

Disease log2 FC p
Breast cancer 1.300 2.9e-05
medulloblastoma, large-cell 1.200 7.6e-05

Protein-protein Interaction (4)

Gene RIF (4)

AA Sequence

MDAELAEVRALQAEIAALRRACEDPPAPWEEKSRVQKSFQAIHQFNLEGWKSSKDLKNQLGHLESELSFL      1 - 70
STLTGINIRNHSKQTEDLTSTEMTEKSIRKVLQRHRLSGNCHMVTFQLEFQILEIQNKERLSSAVTDLNI     71 - 140
IMEPTECSELSEFVSRAEERKDLFMFFRSLHFFVEWFEYRKRTFKHLKEKYPDAVYLSEGPSSCSMGIRS    141 - 210
ASRPGFELVIVWRIQIDEDGKVFPKLDLLTKVPQRALELDKNRAIETAPLSFRTLVGLLGIEAALESLIK    211 - 280
SLCAEENN                                                                  281 - 288
//

Text Mined References (15)

PMID Year Title