Property Summary

NCBI Gene PubMed Count 1
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Expression

  Differential Expression (6)

Disease log2 FC p
adult high grade glioma -1.500 6.3e-04
Astrocytoma, Pilocytic -1.600 7.6e-08
ependymoma -1.200 4.0e-09
glioblastoma -1.200 4.3e-07
group 3 medulloblastoma -1.200 1.3e-02
medulloblastoma, large-cell -1.200 1.7e-02

AA Sequence

MGPPLWPDLQEPPPPGTSSQIRSPLLCDVIKPAPHHDVTVRVVPPPRFLPLLLRPLPSDGDIAMRRDRGP      1 - 70
KPALGGAGEVEPGGMAASPTGRPRRLQRYLQSGEFDQFRDFPIFESNFVQFCPDIYPAPTSDLWPQVTRL     71 - 140
GEVANEVTMGVAASSPALELPDLLLLAGPAKENGHLQLFGLFPLKFVQLFVHDKSRCQLEVKLNTSRTFY    141 - 210
LQLRAPLKTRDREFGQWVRLLYRLRFLSASAVPFTQE                                     211 - 247
//

Text Mined References (2)

PMID Year Title