Property Summary

NCBI Gene PubMed Count 1
PubMed Score 0.00

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
ependymoma -1.200 0.000
glioblastoma -1.200 0.000
medulloblastoma, large-cell -1.200 0.017
adult high grade glioma -1.500 0.001
group 3 medulloblastoma -1.200 0.013
pilocytic astrocytoma -1.600 0.000

AA Sequence

MGPPLWPDLQEPPPPGTSSQIRSPLLCDVIKPAPHHDVTVRVVPPPRFLPLLLRPLPSDGDIAMRRDRGP      1 - 70
KPALGGAGEVEPGGMAASPTGRPRRLQRYLQSGEFDQFRDFPIFESNFVQFCPDIYPAPTSDLWPQVTRL     71 - 140
GEVANEVTMGVAASSPALELPDLLLLAGPAKENGHLQLFGLFPLKFVQLFVHDKSRCQLEVKLNTSRTFY    141 - 210
LQLRAPLKTRDREFGQWVRLLYRLRFLSASAVPFTQE                                     211 - 247
//

Text Mined References (2)

PMID Year Title
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.