Property Summary

NCBI Gene PubMed Count 9
PubMed Score 2.33
PubTator Score 1.33

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (7)

Disease log2 FC p
atypical teratoid / rhabdoid tumor 1.600 4.0e-07
cystic fibrosis -1.005 4.4e-05
glioblastoma 1.100 2.4e-03
medulloblastoma, large-cell 1.200 1.2e-04
ovarian cancer 1.900 4.9e-04
progressive supranuclear palsy -1.200 5.4e-03
sonic hedgehog group medulloblastoma 1.100 2.2e-04

 GO Function (1)

 GO Process (1)

 Compartment GO Term (2)

AA Sequence

MDRSAEFRKWKAQCLSKADLSRKGSVDEDVVELVQFLNMRDQFFTTSSCAGRILLLDRGINGFEVQKQNC      1 - 70
CWLLVTHKLCVKDDVIVALKKANGDATLKFEPFVLHVQCRQLQDAQILHSMAIDSGFRNSGITVGKRGKT     71 - 140
MLAVRSTHGLEVPLSHKGKLMVTEEYIDFLLNVANQKMEENKKRIERFYNCLQHALERETMTNLHPKIKE    141 - 210
KNNSSYIHKKKRNPEKTRAQCITKESDEELENDDDDDLGINVTIFPEDY                         211 - 259
//

Text Mined References (11)

PMID Year Title