Property Summary

NCBI Gene PubMed Count 9
PubMed Score 2.33
PubTator Score 1.33

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
cystic fibrosis -1.005 0.000
atypical teratoid / rhabdoid tumor 1.600 0.000
glioblastoma 1.100 0.002
medulloblastoma, large-cell 1.200 0.000
sonic hedgehog group medulloblastoma 1.100 0.000
progressive supranuclear palsy -1.200 0.005
ovarian cancer 1.900 0.000

AA Sequence

MDRSAEFRKWKAQCLSKADLSRKGSVDEDVVELVQFLNMRDQFFTTSSCAGRILLLDRGINGFEVQKQNC      1 - 70
CWLLVTHKLCVKDDVIVALKKANGDATLKFEPFVLHVQCRQLQDAQILHSMAIDSGFRNSGITVGKRGKT     71 - 140
MLAVRSTHGLEVPLSHKGKLMVTEEYIDFLLNVANQKMEENKKRIERFYNCLQHALERETMTNLHPKIKE    141 - 210
KNNSSYIHKKKRNPEKTRAQCITKESDEELENDDDDDLGINVTIFPEDY                         211 - 259
//

Text Mined References (11)

PMID Year Title
25231870 2014 Parent-of-origin-specific allelic associations among 106 genomic loci for age at menarche.
22843503 2012 Genome-wide association analysis identifies TYW3/CRYZ and NDST4 loci associated with circulating resistin levels.
22589738 2012 Genome-wide association for abdominal subcutaneous and visceral adipose reveals a novel locus for visceral fat in women.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17150819 2006 Ribonucleome analysis identified enzyme genes responsible for wybutosine synthesis.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
More...