Property Summary

NCBI Gene PubMed Count 1
PubMed Score 1.39

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

AA Sequence

MTSIPFPGDRLLQVDGVILCGLTHKQAVQCLKGPGQVARLVLERRVPRSTQQCPSANDSMGDERTAVSLV      1 - 70
TALPGRPSSCVSVTDGPKFEVKLKKNANGLGFSFVQMEKESCSHLKSDLVRIKRLFPGQPAEENGAIAAG     71 - 140
DIILAVNGRSTEGLIFQEVLHLLRGAPQEVTLLLCRPPPGALPEMEQEWQTPELSADKEFTRATCTDSCT    141 - 210
SPILDQEDSWRDSASPDAGEGLGLRPESSQKAIREAQWGQNRERPWASSLTHSPESHPHLCKLHQERDES    211 - 280
TLATSLEKDVRQNCYSVCDIMRLGRYSFSSPLTRLSTDIF                                  281 - 320
//

Text Mined References (4)

PMID Year Title