Property Summary

NCBI Gene PubMed Count 12
PubMed Score 11.91
PubTator Score 2.52

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
posterior fossa group B ependymoma 1530 3.5036176025214E-11
osteosarcoma 7933 4.8829544772577E-7
medulloblastoma, large-cell 6234 4.77703398564939E-6
psoriasis 6685 1.17823150089877E-5
atypical teratoid / rhabdoid tumor 4369 1.45731789049155E-5
group 4 medulloblastoma 1875 8.83122815244478E-5
intraductal papillary-mucinous adenoma (IPMA) 2956 1.46242623080457E-4
ovarian cancer 8492 6.83047540266488E-4
intraductal papillary-mucinous carcinoma (IPMC) 2988 8.36753455690946E-4
primitive neuroectodermal tumor 3031 0.00302844886542141

Expression

Synonym

Accession Q6IN85 Q69YK6 Q86U23 Q86YI7 Q8IVG1 Q9H3F1 Q9H7U8 Q9NV01 Q9NWP1
Symbols smk1
FLFL1
PP4R3
SMEK1
smk-1
PP4R3A
MSTP033
KIAA2010

Gene

  Ortholog (2)

Species Source
Mouse OMA Inparanoid
Zebrafish OMA Inparanoid

Gene RIF (2)

PMID Text
26378810 Loss of sMEK1 is associated with Ovarian Neoplasms.
22349239 The N-terminal of BLU was observed to interact with the C-terminal of SMEK1, a regulatory subunit of protein phosphatase 4. Furthermore, we determined the binding domains that are required for interaction between BLU and sMEK1. The N-terminal of BLU was observed to interact with the C-terminal of sMEK1.

AA Sequence

MTDTRRRVKVYTLNEDRQWDDRGTGHVSSGYVERLKGMSLLVRAESDGSLLLESKINPNTAYQKQQDTLI      1 - 70
VWSEAENYDLALSFQEKAGCDEIWEKICQVQGKDPSVDITQDLVDESEEERFDDMSSPGLELPSCELSRL     71 - 140
EEIAELVASSLPSPLRREKLALALENEGYIKKLLELFHVCEDLENIEGLHHLYEIIKGIFLLNRTALFEV    141 - 210
MFSEECIMDVIGCLEYDPALSQPRKHREFLTKTAKFKEVIPISDPELKQKIHQTYRVQYIQDMVLPTPSV    211 - 280
FEENMLSTLHSFIFFNKVEIVGMLQEDEKFLTDLFAQLTDEATDEEKRQELVNFLKEFCAFSQTLQPQNR    281 - 350
DAFFKTLSNMGILPALEVILGMDDTQVRSAATDIFSYLVEYNPSMVREFVMQEAQQNDDVSKKLTEQKIT    351 - 420
SKDILLINLIIEHMICDTDPELGGAVQLMGLLRTLVDPENMLATANKTEKTEFLGFFYKHCMHVLTAPLL    421 - 490
ANTTEDKPSKDDFQTAQLLALVLELLTFCVEHHTYHIKNYIINKDILRRVLVLMASKHAFLALCALRFKR    491 - 560
KIIGLKDEFYNRYIMKSFLFEPVVKAFLNNGSRYNLMNSAIIEMFEFIRVEDIKSLTAHVIENYWKALED    561 - 630
VDYVQTFKGLKLRFEQQRERQDNPKLDSMRSILRNHRYRRDARTLEDEEEMWFNTDEDDMEDGEAVVSPS    631 - 700
DKTKNDDDIMDPISKFMERKKLKESEEKEVLLKTNLSGRQSPSFKLSLSSGTKTNLTSQSSTTNLPGSPG    701 - 770
SPGSPGSPGSPGSVPKNTSQTAAITTKGGLVGLVDYPDDDEDDDEDEDKEDTLPLSKKAKFDS           771 - 833
//

Text Mined References (23)

PMID Year Title
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
26378810 2015 sMEK1 inhibits endothelial cell proliferation by attenuating VEGFR-2-dependent-Akt/eNOS/HIF-1? signaling pathways.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22349239 2012 Tumor suppressor BLU enhances pro-apoptotic activity of sMEK1 through physical interaction.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
More...