Property Summary

NCBI Gene PubMed Count 15
PubMed Score 14.51
PubTator Score 2.52

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
atypical teratoid / rhabdoid tumor 1.100 1.5e-05
ependymoma 1.800 1.2e-02
group 3 medulloblastoma 1.100 2.0e-02
intraductal papillary-mucinous adenoma (... 1.300 1.5e-04
intraductal papillary-mucinous carcinoma... 1.300 8.4e-04
medulloblastoma, large-cell 1.600 4.8e-06
osteosarcoma 1.739 4.9e-07
ovarian cancer 1.100 6.8e-04
primitive neuroectodermal tumor 1.100 3.0e-03
psoriasis -2.400 1.9e-05

Gene RIF (4)

AA Sequence

MTDTRRRVKVYTLNEDRQWDDRGTGHVSSGYVERLKGMSLLVRAESDGSLLLESKINPNTAYQKQQDTLI      1 - 70
VWSEAENYDLALSFQEKAGCDEIWEKICQVQGKDPSVDITQDLVDESEEERFDDMSSPGLELPSCELSRL     71 - 140
EEIAELVASSLPSPLRREKLALALENEGYIKKLLELFHVCEDLENIEGLHHLYEIIKGIFLLNRTALFEV    141 - 210
MFSEECIMDVIGCLEYDPALSQPRKHREFLTKTAKFKEVIPISDPELKQKIHQTYRVQYIQDMVLPTPSV    211 - 280
FEENMLSTLHSFIFFNKVEIVGMLQEDEKFLTDLFAQLTDEATDEEKRQELVNFLKEFCAFSQTLQPQNR    281 - 350
DAFFKTLSNMGILPALEVILGMDDTQVRSAATDIFSYLVEYNPSMVREFVMQEAQQNDDVSKKLTEQKIT    351 - 420
SKDILLINLIIEHMICDTDPELGGAVQLMGLLRTLVDPENMLATANKTEKTEFLGFFYKHCMHVLTAPLL    421 - 490
ANTTEDKPSKDDFQTAQLLALVLELLTFCVEHHTYHIKNYIINKDILRRVLVLMASKHAFLALCALRFKR    491 - 560
KIIGLKDEFYNRYIMKSFLFEPVVKAFLNNGSRYNLMNSAIIEMFEFIRVEDIKSLTAHVIENYWKALED    561 - 630
VDYVQTFKGLKLRFEQQRERQDNPKLDSMRSILRNHRYRRDARTLEDEEEMWFNTDEDDMEDGEAVVSPS    631 - 700
DKTKNDDDIMDPISKFMERKKLKESEEKEVLLKTNLSGRQSPSFKLSLSSGTKTNLTSQSSTTNLPGSPG    701 - 770
SPGSPGSPGSPGSVPKNTSQTAAITTKGGLVGLVDYPDDDEDDDEDEDKEDTLPLSKKAKFDS           771 - 833
//

Text Mined References (25)

PMID Year Title