Property Summary

NCBI Gene PubMed Count 12
PubMed Score 3.01
PubTator Score 3.66

Knowledge Summary

Patent

No data available

Gene RIF (2)

AA Sequence

MALLSTVRGATWGRLVTRHFSHAARHGERPGGEELSRLLLDDLVPTSRLELLFGMTPCLLALQAARRSVA      1 - 70
RLLLQAGKAGLQGKRAELLRMAEARDIPVLRPRRQKLDTMCRYQVHQGVCMEVSPLRPRPWREAGEASPG     71 - 140
DDPQQLWLVLDGIQDPRNFGAVLRSAHFLGVDKVITSRRNSCPLTPVVSKSSAGAMEVMDVFSTDDLTGF    141 - 210
LQTKAQQGWLVAGTVGCPSTEDPQSSEIPIMSCLEFLWERPTLLVLGNEGSGLSQEVQASCQLLLTILPR    211 - 280
RQLPPGLESLNVSVAAGILLHSICSQRKGFPTEGERRQLLQDPQEPSARSEGLSMAQHPGLSSGPEKERQ    281 - 350
NEG                                                                       351 - 353
//

Text Mined References (15)

PMID Year Title