Property Summary

NCBI Gene PubMed Count 9
Grant Count 2
R01 Count 2
Funding $160,707.8
PubMed Score 3.55
PubTator Score 5.31

Knowledge Summary

Patent

No data available

Gene RIF (3)

PMID Text
24335393 Our findings are the first to characterize the regulation of human SULT1C2 and SULT1C3 expression by several transcription factor activators.
24335392 These data indicate that SULT1C3 is expressed in human intestine.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)

AA Sequence

MAKIEKNAPTMEKKPELFNIMEVDGVPTLILSKEWWEKVCNFQAKPDDLILATYPKSGTTWMHEILDMIL      1 - 70
NDGDVEKCKRAQTLDRHAFLELKFPHKEKPDLEFVLEMSSPQLIKTHLPSHLIPPSIWKENCKIVYVARN     71 - 140
PKDCLVSYYHFHRMASFMPDPQNLEEFYEKFMSGKVVGGSWFDHVKGWWAAKDMHRILYLFYEDIKKDPK    141 - 210
REIEKILKFLEKDISEEILNKIIYHTSFDVMKQNPMTNYTTLPTSIMDHSISPFMRKGMPGDWKNYFTVA    211 - 280
QNEEFDKDYQKKMAGSTLTFRTEI                                                  281 - 304
//

Text Mined References (9)

PMID Year Title
24954895 2014 Gene-age interactions in blood pressure regulation: a large-scale investigation with the CHARGE, Global BPgen, and ICBP Consortia.
24335393 2014 Regulation of human cytosolic sulfotransferases 1C2 and 1C3 by nuclear signaling pathways in LS180 colorectal adenocarcinoma cells.
24335392 2014 Expression of the orphan cytosolic sulfotransferase SULT1C3 in human intestine: characterization of the transcript variant and implications for function.
24028175 2013 Expression of the sulfotransferase 1C family: implications for xenobiotic toxicity.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
17936463 2008 SULT1C3, an orphan sequence of the human genome, encodes an enzyme activating various promutagens.
17425406 2007 Structural and chemical profiling of the human cytosolic sulfotransferases.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
14676822 2004 Human cytosolic sulfotransferase database mining: identification of seven novel genes and pseudogenes.