Property Summary

NCBI Gene PubMed Count 10
PubMed Score 4.41
PubTator Score 5.31

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count Z-score Confidence
Chemical and Drug Induced Liver Injury 195 0.0 0.0
Disease Target Count Z-score Confidence
Melanoma 711 0.0 0.5
Skin cancer 469 0.0 0.5
Disease Target Count Z-score Confidence
Rheumatoid arthritis 1191 0.0 0.9

Gene RIF (4)

AA Sequence

MAKIEKNAPTMEKKPELFNIMEVDGVPTLILSKEWWEKVCNFQAKPDDLILATYPKSGTTWMHEILDMIL      1 - 70
NDGDVEKCKRAQTLDRHAFLELKFPHKEKPDLEFVLEMSSPQLIKTHLPSHLIPPSIWKENCKIVYVARN     71 - 140
PKDCLVSYYHFHRMASFMPDPQNLEEFYEKFMSGKVVGGSWFDHVKGWWAAKDMHRILYLFYEDIKKDPK    141 - 210
REIEKILKFLEKDISEEILNKIIYHTSFDVMKQNPMTNYTTLPTSIMDHSISPFMRKGMPGDWKNYFTVA    211 - 280
QNEEFDKDYQKKMAGSTLTFRTEI                                                  281 - 304
//

Text Mined References (10)

PMID Year Title