Property Summary

NCBI Gene PubMed Count 7
PubMed Score 1.72
PubTator Score 3.08

Knowledge Summary

Patent

No data available

Gene RIF (1)

AA Sequence

MADKSKFIEYIDEALEKSKETALSHLFFTYQGIPYPITMCTSETFQALDTFEARHDDIVLASYPKCGSNW      1 - 70
ILHIVSELIYAVSKKKYKYPEFPVLECGDSEKYQRMKGFPSPRILATHLHYDKLPGSIFENKAKILVIFR     71 - 140
NPKDTAVSFLHFHNDVPDIPSYGSWDEFFRQFMKGQVSWGRYFDFAINWNKHLDGDNVKFILYEDLKENL    141 - 210
AAGIKQIAEFLGFFLTGEQIQTISVQSTFQAMRAKSQDTHGAVGPFLFRKGEVGDWKNLFSEIQNQEMDE    211 - 280
KFKECLAGTSLGAKLKYESYCQG                                                   281 - 303
//

Text Mined References (9)

PMID Year Title