Property Summary

NCBI Gene PubMed Count 6
PubMed Score 2.06
PubTator Score 3.08

Knowledge Summary

Patent

No data available

Gene RIF (1)

PMID Text
20832056 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)

AA Sequence

MADKSKFIEYIDEALEKSKETALSHLFFTYQGIPYPITMCTSETFQALDTFEARHDDIVLASYPKCGSNW      1 - 70
ILHIVSELIYAVSKKKYKYPEFPVLECGDSEKYQRMKGFPSPRILATHLHYDKLPGSIFENKAKILVIFR     71 - 140
NPKDTAVSFLHFHNDVPDIPSYGSWDEFFRQFMKGQVSWGRYFDFAINWNKHLDGDNVKFILYEDLKENL    141 - 210
AAGIKQIAEFLGFFLTGEQIQTISVQSTFQAMRAKSQDTHGAVGPFLFRKGEVGDWKNLFSEIQNQEMDE    211 - 280
KFKECLAGTSLGAKLKYESYCQG                                                   281 - 303
//

Text Mined References (8)

PMID Year Title
23974872 2013 Genome-wide association analysis identifies 13 new risk loci for schizophrenia.
20832056 2011 Genome-wide association study of schizophrenia in a Japanese population.
19505954 2009 Molecular cloning, expression and characterization of a novel mouse SULT6 cytosolic sulfotransferase.
17425406 2007 Structural and chemical profiling of the human cytosolic sulfotransferases.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14676822 2004 Human cytosolic sulfotransferase database mining: identification of seven novel genes and pseudogenes.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.