Property Summary

NCBI Gene PubMed Count 3
PubMed Score 1.00
PubTator Score 240.80

Knowledge Summary

Patent (213)

TINX Plot

  Disease (2)

Disease Target Count P-value
diabetes mellitus 1728 1.5e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.5

AA Sequence

MSGENVTKVSTFILVGLPTAPGLQYLLFLLFLLTYLFVLVENLAIILIVWSSTSLHRPMYYFLSSMSFLE      1 - 70
IWYVSDITPKMLEGFLLQQKRISFVGCMTQLYFFSSLVCTECVLLASMAYDRYVAICHPLRYHVLVTPGL     71 - 140
CLQLVGFSFVSGFTISMIKVCFISSVTFCGSNVLNHFFCDISPILKLACTDFSTAELVDFILAFIILVFP    141 - 210
LLATILSYWHITLAVLRIPSATGCWRAFSTCASHLTVVTVFYTALLFMYVRPQAIDSQSSNKLISAVYTV    211 - 280
VTPIINPLIYCLRNKEFKDALKKALGLGQTSH                                          281 - 312
//

Text Mined References (4)

PMID Year Title