Property Summary

NCBI Gene PubMed Count 3
PubMed Score 1.00
PubTator Score 240.80

Knowledge Summary

Patent (213)

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
diabetes mellitus 1,663

AA Sequence

MSGENVTKVSTFILVGLPTAPGLQYLLFLLFLLTYLFVLVENLAIILIVWSSTSLHRPMYYFLSSMSFLE      1 - 70
IWYVSDITPKMLEGFLLQQKRISFVGCMTQLYFFSSLVCTECVLLASMAYDRYVAICHPLRYHVLVTPGL     71 - 140
CLQLVGFSFVSGFTISMIKVCFISSVTFCGSNVLNHFFCDISPILKLACTDFSTAELVDFILAFIILVFP    141 - 210
LLATILSYWHITLAVLRIPSATGCWRAFSTCASHLTVVTVFYTALLFMYVRPQAIDSQSSNKLISAVYTV    211 - 280
VTPIINPLIYCLRNKEFKDALKKALGLGQTSH                                          281 - 312
//

Text Mined References (4)

PMID Year Title
23910658 2013 Identification of regions associated with variation in sensitivity to food-related odors in the human genome.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14983052 2004 The human olfactory receptor gene family.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.