Property Summary

NCBI Gene PubMed Count 2
PubMed Score 0.17
PubTator Score 170.39

Knowledge Summary

Patent (356)

TINX Plot

  Disease (1)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6

AA Sequence

MERVNETVVREVIFLGFSSLARLQQLLFVIFLLLYLFTLGTNAIIISTIVLDRALHIPMYFFLAILSCSE      1 - 70
ICYTFIIVPKMLVDLLSQKKTISFLGCAIQMFSFLFLGCSHSFLLAVMGYDRYIAICNPLRYSVLMGHGV     71 - 140
CMGLVAAACACGFTVAQIITSLVFHLPFYSSNQLHHFFCDIAPVLKLASHHNHFSQIVIFMLCTLVLAIP    141 - 210
LLLILVSYVHILSAILQFPSTLGRCKAFSTCVSHLIIVTVHYGCASFIYLRPQSNYSSSQDALISVSYTI    211 - 280
ITPLFNPMIYSLRNKEFKSALCKIVRRTISLL                                          281 - 312
//

Text Mined References (2)

PMID Year Title