Property Summary

NCBI Gene PubMed Count 4
PubMed Score 0.00
PubTator Score 3.00

Knowledge Summary

Patent (111)

AA Sequence

MEGNQTWITDITLLGFQVGPALAILLCGLFSVFYTLTLLGNGVIFGIICLDSKLHTPMYFFLSHLAIIDM      1 - 70
SYASNNVPKMLANLMNQKRTISFVPCIMQTFLYLAFAVTECLILVVMSYDRYVAICHPFQYTVIMSWRVC     71 - 140
TILVLTSWSCGFALSLVHEILLLRLPFCGPRDVNHLFCEILSVLKLACADTWVNQVVIFATCVFVLVGPL    141 - 210
SLILVSYMHILGAILKIQTKEGRIKAFSTCSSHLCVVGLFFGIAMVVYMVPDSNQREEQEKMLSLFHSVF    211 - 280
NPMLNPLIYSLRNAQLKGALHRALQRKRSMRTVYGLCL                                    281 - 318
//

Text Mined References (5)

PMID Year Title