Property Summary

NCBI Gene PubMed Count 2
PubMed Score 0.71

Knowledge Summary

Patent (99)

TINX Plot

  Disease (1)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.7

AA Sequence

MQQNNSVPEFILLGLTQDPLRQKIVFVIFLIFYMGTVVGNMLIIVTIKSSRTLGSPMYFFLFYLSFADSC      1 - 70
FSTSTAPRLIVDALSEKKIITYNECMTQVFALHLFGCMEIFVLILMAVDRYVAICKPLRYPTIMSQQVCI     71 - 140
ILIVLAWIGSLIHSTAQIILALRLPFCGPYLIDHYCCDLQPLLKLACMDTYMINLLLVSNSGAICSSSFM    141 - 210
ILIISYIVILHSLRNHSAKGKKKALSACTSHIIVVILFFGPCIFIYTRPPTTFPMDKMVAVFYTIGTPFL    211 - 280
NPLIYTLRNAEVKNAMRKLWHGKIISENKG                                            281 - 310
//

Text Mined References (3)

PMID Year Title