Property Summary

NCBI Gene PubMed Count 1
PubMed Score 0.00

Knowledge Summary

Patent

No data available

AA Sequence

MLAVLYLLVKTAKLGTSWNYLFDFHPHRVLVVGAFANFCTEPTGCSCLFPKLPPHLLMLPCWFHLLFFQD      1 - 70
YIMSGASALPPGLVSFVKAPLPQWWPGGCPGVGGPLQALEAKPGQLSLPIRNQKRLVKSALELGENELFQ     71 - 140
QFPNPQSSWVQRTQEALRPLLSVALQLFLGRRGLPLPFRAPIRTVVGSAIPVQQSPPPSPAQVDTLQARY    141 - 210
VGRLTQLFEEHQARYGVPADRHLVLTEARPTAWPRLSAG                                   211 - 249
//

Text Mined References (2)

PMID Year Title
14970677 2003 Genomic organization of the DGAT2/MOGAT gene family in cattle (Bos taurus) and other mammals.
12853948 2003 The DNA sequence of human chromosome 7.