Property Summary

NCBI Gene PubMed Count 30
PubMed Score 13.27
PubTator Score 9.93

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (19)

Disease log2 FC p
active Crohn's disease 1.035 3.3e-02
aldosterone-producing adenoma -1.211 2.2e-02
Breast cancer -1.100 3.2e-04
breast carcinoma -1.100 1.8e-05
ductal carcinoma in situ -1.400 4.1e-04
ependymoma 1.400 9.6e-03
group 3 medulloblastoma 1.100 1.3e-02
intraductal papillary-mucinous carcinoma... -1.100 4.1e-02
intraductal papillary-mucinous neoplasm ... -1.600 4.1e-03
invasive ductal carcinoma -1.100 6.6e-03
lung adenocarcinoma -1.800 2.0e-14
non-small cell lung cancer -1.310 2.1e-13
osteosarcoma -1.010 4.1e-05
ovarian cancer -1.200 3.3e-05
pancreatic cancer -1.100 6.1e-05
psoriasis -1.300 3.9e-10
spina bifida -1.182 3.4e-02
subependymal giant cell astrocytoma -1.251 7.8e-03
ulcerative colitis 1.100 7.4e-04

Gene RIF (16)

AA Sequence

MKRGRLPSSSEDSDDNGSLSTTWSQNSRSQHRRSSCSRHEDRKPSEVFRTDLITAMKLHDSYQLNPDEYY      1 - 70
VLADPWRQEWEKGVQVPVSPGTIPQPVARVVSEEKSLMFIRPKKYIVSSGSEPPELGYVDIRTLADSVCR     71 - 140
YDLNDMDAAWLELTNEEFKEMGMPELDEYTMERVLEEFEQRCYDNMNHAIETEEGLGIEYDEDVVCDVCQ    141 - 210
SPDGEDGNEMVFCDKCNICVHQACYGILKVPEGSWLCRTCALGVQPKCLLCPKKGGAMKPTRSGTKWVHV    211 - 280
SCALWIPEVSIGSPEKMEPITKVSHIPSSRWALVCSLCNEKFGASIQCSVKNCRTAFHVTCAFDRGLEMK    281 - 350
TILAENDEVKFKSYCPKHSSHRKPEESLGKGAAQENGAPECSPRNPLEPFASLEQNREEAHRVSVRKQKL    351 - 420
QQLEDEFYTFVNLLDVARALRLPEEVVDFLYQYWKLKRKVNFNKPLITPKKDEEDNLAKREQDVLFRRLQ    421 - 490
LFTHLRQDLERVRNLTYMVTRREKIKRSVCKVQEQIFNLYTKLLEQERVSGVPSSCSSSSLENMLLFNSP    491 - 560
SVGPDAPKIEDLKWHSAFFRKQMGTSLVHSLKKPHKRDPLQNSPGSEGKTLLKQPDLCGRREGMVVPESF    561 - 630
LGLEKTFAEARLISAQQKNGVVMPDHGKRRDNRFHCDLIKGDLKDKSFKQSHKPLRSTDVSQRHLDNTRA    631 - 700
ATSPGVGQSAPGTRKEIVPKCNGSLIKVNYNQTAVKVPTTPASPVKNWGGFRIPKKGERQQQGEAHDGAC    701 - 770
HQHSDYPYLGLGRVPAKERAKSKLKSDNENDGYVPDVEMSDSESEASEKKCIHTSSTISRRTDIIRRSIL    771 - 840
AS                                                                        841 - 842
//

Text Mined References (37)

PMID Year Title