Property Summary

NCBI Gene PubMed Count 26
Grant Count 25
R01 Count 23
Funding $2,849,013.1
PubMed Score 12.18
PubTator Score 9.93

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (19)

Disease log2 FC p
ependymoma 1.400 0.010
psoriasis -1.400 0.000
osteosarcoma -2.469 0.000
group 3 medulloblastoma 1.800 0.021
non-small cell lung cancer -1.519 0.000
intraductal papillary-mucinous carcinoma... -1.100 0.041
intraductal papillary-mucinous neoplasm ... -2.000 0.006
active Crohn's disease 1.035 0.033
pancreatic cancer -1.100 0.000
breast carcinoma -1.100 0.000
aldosterone-producing adenoma -1.211 0.022
subependymal giant cell astrocytoma -1.251 0.008
lung adenocarcinoma -1.800 0.000
spina bifida -1.182 0.034
ductal carcinoma in situ -1.400 0.000
invasive ductal carcinoma -1.400 0.002
ulcerative colitis 1.100 0.001
ovarian cancer -1.400 0.000
Breast cancer -1.100 0.000

Gene RIF (12)

PMID Text
26151225 JADE1S protein localized to centrosomes in interphase and mitotic cells, and to the midbody during cytokinesis.
25100726 Casein kinase 1 alpha specifically phosphorylates Jade-1 at an unprimed SLS phosphorylation site.
24739512 Increase in the number of cells with cytoplasmic JADE1S correlated with activation of tubular cell proliferation and inversely correlated with the number of cells with nuclear JADE1S, supporting role of HBO1-JADE1 shuttling during organ regeneration.
24097061 lncRNA-JADE is a key functional link that connects the DDR to histone H4 acetylation, and that dysregulation of lncRNA-JADE may contribute to breast tumorigenesis.
23824745 Reduced Jade-1 expression is associated with clear-cell renal cell carcinomas.
22654112 The ciliary protein nephrocystin-4 translocates the canonical Wnt regulator Jade-1 to the nucleus to negatively regulate beta-catenin signaling.
22516360 RCC with a low expression of Jade-1 is associated with a poor outcome and decreased survival
18806787 The pVHL tumour suppressor and the Wnt tumorigenesis pathway are therefore directly linked through Jade-1.
18684714 Jade-1/1L are crucial co-factors for HBO1-mediated histone H4 acetylation
16046545 Jade-1 may suppress renal cancer cell growth in part by increasing apoptosis.
More...

AA Sequence

MKRGRLPSSSEDSDDNGSLSTTWSQNSRSQHRRSSCSRHEDRKPSEVFRTDLITAMKLHDSYQLNPDEYY      1 - 70
VLADPWRQEWEKGVQVPVSPGTIPQPVARVVSEEKSLMFIRPKKYIVSSGSEPPELGYVDIRTLADSVCR     71 - 140
YDLNDMDAAWLELTNEEFKEMGMPELDEYTMERVLEEFEQRCYDNMNHAIETEEGLGIEYDEDVVCDVCQ    141 - 210
SPDGEDGNEMVFCDKCNICVHQACYGILKVPEGSWLCRTCALGVQPKCLLCPKKGGAMKPTRSGTKWVHV    211 - 280
SCALWIPEVSIGSPEKMEPITKVSHIPSSRWALVCSLCNEKFGASIQCSVKNCRTAFHVTCAFDRGLEMK    281 - 350
TILAENDEVKFKSYCPKHSSHRKPEESLGKGAAQENGAPECSPRNPLEPFASLEQNREEAHRVSVRKQKL    351 - 420
QQLEDEFYTFVNLLDVARALRLPEEVVDFLYQYWKLKRKVNFNKPLITPKKDEEDNLAKREQDVLFRRLQ    421 - 490
LFTHLRQDLERVRNLTYMVTRREKIKRSVCKVQEQIFNLYTKLLEQERVSGVPSSCSSSSLENMLLFNSP    491 - 560
SVGPDAPKIEDLKWHSAFFRKQMGTSLVHSLKKPHKRDPLQNSPGSEGKTLLKQPDLCGRREGMVVPESF    561 - 630
LGLEKTFAEARLISAQQKNGVVMPDHGKRRDNRFHCDLIKGDLKDKSFKQSHKPLRSTDVSQRHLDNTRA    631 - 700
ATSPGVGQSAPGTRKEIVPKCNGSLIKVNYNQTAVKVPTTPASPVKNWGGFRIPKKGERQQQGEAHDGAC    701 - 770
HQHSDYPYLGLGRVPAKERAKSKLKSDNENDGYVPDVEMSDSESEASEKKCIHTSSTISRRTDIIRRSIL    771 - 840
AS                                                                        841 - 842
//

Text Mined References (32)

PMID Year Title
26151225 2015 The novel function of JADE1S in cytokinesis of epithelial cells.
25416956 2014 A proteome-scale map of the human interactome network.
25100726 2014 Casein kinase 1 ? phosphorylates the Wnt regulator Jade-1 and modulates its activity.
24739512 2014 Cell cycle-dependent chromatin shuttling of HBO1-JADE1 histone acetyl transferase (HAT) complex.
24097061 2013 A novel non-coding RNA lncRNA-JADE connects DNA damage signalling to histone H4 acetylation.
23824745 2013 Candidate tumor suppressor and pVHL partner Jade-1 binds and inhibits AKT in renal cell carcinoma.
23400010 2014 Genome-wide association analyses suggest NELL1 influences adverse metabolic response to HCTZ in African Americans.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23001567 2012 Polycystin-1 regulates the stability and ubiquitination of transcription factor Jade-1.
22654112 2012 The ciliary protein nephrocystin-4 translocates the canonical Wnt regulator Jade-1 to the nucleus to negatively regulate ?-catenin signaling.
More...