Property Summary

NCBI Gene PubMed Count 1
PubMed Score 0.00

Knowledge Summary

Patent

No data available

AA Sequence

MAKSFPVFSLLSFILIHLVLSSVSGPRHWWPPRGIIKVKCPYEKVNLSWYNGTVNPCPGLYQPICGTNFI      1 - 70
TYDNPCILCVESLKSHGRIRFYHDGKC                                                71 - 97
//

Text Mined References (2)

PMID Year Title
15060002 2004 A genomic analysis of rat proteases and protease inhibitors.
14574404 2003 The DNA sequence and analysis of human chromosome 6.