Knowledge Summary


No data available


  Disease Sources (1)

Disease Target Count P-value
psoriasis 6685 5.41014694730067E-23
lung carcinoma 2844 1.70425301017535E-10

AA Sequence

VEQSNLVFNIQPAPGMVYDYYEKDGEAFLLTN                                         1401 - 1432

Text Mined References (2)

PMID Year Title
16541075 2006 The finished DNA sequence of human chromosome 12.
15060002 2004 A genomic analysis of rat proteases and protease inhibitors.