Property Summary

NCBI Gene PubMed Count 2
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (5)

Disease log2 FC p
group 4 medulloblastoma -1.100 4.4e-04
medulloblastoma, large-cell -1.200 3.0e-04
pituitary cancer 1.100 4.3e-03
posterior fossa group B ependymoma -1.200 3.9e-08
tuberculosis -1.300 3.8e-04

AA Sequence

MCRCPPEHHDGRMTSAEVGAAAGGAQAAGPPEWPPGSPQALRQPGRARVAMAALVWLLAGASMSSLNKWI      1 - 70
FTVHGFGRPLLLSALHMLVAALACHRGARRPMPGGTRCRVLLLSLTFGTSMACGNVGLRAVPLDLAQLVT     71 - 140
TTTPLFTLALSALLLGRRHHPLQLAAMGPLCLGAACSLAGEFRTPPTGCGFLLAATCLRGLKSVQQSALL    141 - 210
QEERLDAVTLLYATSLPSFCLLAGAALVLEAGVAPPPTAGDSRLWACILLSCLLSVLYNLASFSLLALTS    211 - 280
ALTVHVLGNLTVVGNLILSRLLFGSRLSALSYVGIALTLSGMFLYHNCEFVASWAARRGLWRRDQPSKGL    281 - 350
//

Text Mined References (3)

PMID Year Title