Property Summary

NCBI Gene PubMed Count 2
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
posterior fossa group B ependymoma 1530 3.87907285450453E-8
medulloblastoma, large-cell 6234 3.0066380358024E-4
sonic hedgehog group medulloblastoma 1482 3.15641129785197E-4
tuberculosis 1563 3.84320723283379E-4
pituitary cancer 1972 0.00432360429257359

Expression

  Differential Expression (5)

Disease log2 FC p
sonic hedgehog group medulloblastoma -1.200 0.000
medulloblastoma, large-cell -1.200 0.000
tuberculosis -1.300 0.000
posterior fossa group B ependymoma -1.200 0.000
pituitary cancer 1.100 0.004

Synonym

Accession Q6ICL7 Q567P0
Symbols

Gene

PANTHER Protein Class (1)

  Ortholog (9)

AA Sequence

MCRCPPEHHDGRMTSAEVGAAAGGAQAAGPPEWPPGSPQALRQPGRARVAMAALVWLLAGASMSSLNKWI      1 - 70
FTVHGFGRPLLLSALHMLVAALACHRGARRPMPGGTRCRVLLLSLTFGTSMACGNVGLRAVPLDLAQLVT     71 - 140
TTTPLFTLALSALLLGRRHHPLQLAAMGPLCLGAACSLAGEFRTPPTGCGFLLAATCLRGLKSVQQSALL    141 - 210
QEERLDAVTLLYATSLPSFCLLAGAALVLEAGVAPPPTAGDSRLWACILLSCLLSVLYNLASFSLLALTS    211 - 280
ALTVHVLGNLTVVGNLILSRLLFGSRLSALSYVGIALTLSGMFLYHNCEFVASWAARRGLWRRDQPSKGL    281 - 350
//

Text Mined References (3)

PMID Year Title
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15461802 2004 A genome annotation-driven approach to cloning the human ORFeome.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.