Property Summary

NCBI Gene PubMed Count 7
PubMed Score 0.17

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (25)

Gene RIF (1)

AA Sequence

MVWAPLGPPRTDCLTLLHTPSKDSPKMSLEWLVAWSWSLDGLRDCIATGIQSVRDCDTTAVITVACLLVL      1 - 70
FVWYCYHVGREQPRPYVSVNSLMQAADANGLQNGYVYCQSPECVRCTHNEGLNQKLYHNLQEYAKRYSWS     71 - 140
GMGRIHKGIREQGRYLNSRPSIQKPEVFFLPDLPTTPYFSRDAQKHDVEVLERNFQTILCEFETLYKAFS    141 - 210
NCSLPQGWKMNSTPSGEWFTFYLVNQGVCVPRNCRKCPRTYRLLGSLRTCIGNNVFGNACISVLSPGTVI    211 - 280
TEHYGPTNIRIRCHLGLKTPNGCELVVGGEPQCWAEGRCLLFDDSFLHAAFHEGSAEDGPRVVFMVDLWH    281 - 350
PNVAAAERQALDFIFAPGR                                                       351 - 369
//

Text Mined References (8)

PMID Year Title