Property Summary

NCBI Gene PubMed Count 7
PubMed Score 0.17

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
lung carcinoma 2844 4.54118819166205E-16
ulcerative colitis 2087 1.65065889792566E-9
non-small cell lung cancer 2798 7.43388251568316E-9
glioblastoma 5572 5.00512302524856E-7
pediatric high grade glioma 2712 7.14545614951766E-7
pilocytic astrocytoma 3086 1.26189345690413E-6
atypical teratoid / rhabdoid tumor 4369 8.34688702465493E-6
group 4 medulloblastoma 1875 1.04451549039059E-5
pancreatic cancer 2300 1.49913162664277E-5
intraductal papillary-mucinous adenoma (IPMA) 2956 8.67316932805636E-5
tuberculosis 1563 1.56679853295344E-4
medulloblastoma, large-cell 6234 2.00975357926518E-4
osteosarcoma 7933 7.82263042698852E-4
ependymoma 2514 0.00113478461514484
astrocytic glioma 2241 0.00123324977890009
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.00316111144260305
oligodendroglioma 2849 0.00385008661415668
invasive ductal carcinoma 2950 0.00489782822107484
primitive neuroectodermal tumor 3031 0.005188370039186
active Crohn's disease 918 0.00609922944006855
interstitial cystitis 2299 0.00675530363937176
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.0134138052809952
subependymal giant cell astrocytoma 2287 0.0145535758757001
ductal carcinoma in situ 1745 0.0184289192985096
progressive supranuclear palsy 674 0.047548607240741

Expression

Synonym

Accession Q6ICH7 B2RCH3 Q7L0W3 Q9NSN3
Symbols

Gene

PANTHER Protein Class (2)

  Ortholog (13)

Gene RIF (1)

PMID Text
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)

AA Sequence

MVWAPLGPPRTDCLTLLHTPSKDSPKMSLEWLVAWSWSLDGLRDCIATGIQSVRDCDTTAVITVACLLVL      1 - 70
FVWYCYHVGREQPRPYVSVNSLMQAADANGLQNGYVYCQSPECVRCTHNEGLNQKLYHNLQEYAKRYSWS     71 - 140
GMGRIHKGIREQGRYLNSRPSIQKPEVFFLPDLPTTPYFSRDAQKHDVEVLERNFQTILCEFETLYKAFS    141 - 210
NCSLPQGWKMNSTPSGEWFTFYLVNQGVCVPRNCRKCPRTYRLLGSLRTCIGNNVFGNACISVLSPGTVI    211 - 280
TEHYGPTNIRIRCHLGLKTPNGCELVVGGEPQCWAEGRCLLFDDSFLHAAFHEGSAEDGPRVVFMVDLWH    281 - 350
PNVAAAERQALDFIFAPGR                                                       351 - 369
//

Text Mined References (8)

PMID Year Title
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19946888 2010 Defining the membrane proteome of NK cells.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15461802 2004 A genome annotation-driven approach to cloning the human ORFeome.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10591208 1999 The DNA sequence of human chromosome 22.