Property Summary

NCBI Gene PubMed Count 10
PubMed Score 79.73
PubTator Score 46.99

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (2)

Disease log2 FC p
Breast cancer -1.200 0.000
pituitary cancer 1.300 0.004

Gene RIF (4)

PMID Text
26116451 Conclude that human PAWP is neither sufficient nor necessary for the Ca(2+) oscillations that initiate mammalian oocyte activation at fertilization.
25722320 Data suggest that PAWP (WW domain-binding protein 2-like) from sperm (rather than PLCZ [phospholipase C zeta] from sperm) acts as the 'sperm factor' within the egg at fertilization and is involved in 'egg activation' and embryogenesis. [REVIEW]
25417742 WBP2NL might play roles as an anti-apoptotic factor or co-activator to promote breast cancer cell survival and proliferation.
24907910 Demonstrate significant correlations between sperm PAWP levels and both fertilization rates and normal embryonic development after intracytoplasmic sperm injection.

AA Sequence

MAVNQSHTENRRGALIPNGESLLKRSPNVELSFPQRSEGSNVFSGRKTGTLFLTSYRVIFITSCSISDPM      1 - 70
LSFMMPFDLMTNLTVEQPVFAANFIKGTIQAAPYGGWEGQATFKLVFRNGDAIEFAQLMVKAASAAARGF     71 - 140
PLRTLNDWFSSMGIYVITGEGNMCTPQMPCSVIVYGAPPAGYGAPPPGYGAPPAGYGAQPVGNEGPPVGY    141 - 210
RASPVRYGAPPLGYGAPPAGYGAPPLGYGAPPLGYGTPPLGYGAPPLGYGAPPAGNEGPPAGYRASPAGS    211 - 280
GARPQESTAAQAPENEASLPSASSSQVHS                                             281 - 309
//

Text Mined References (13)

PMID Year Title
26116451 2015 Functional disparity between human PAWP and PLC? in the generation of Ca2+ oscillations for oocyte activation.
25722320 2015 PLC? or PAWP: revisiting the putative mammalian sperm factor that triggers egg activation and embryogenesis.
25417742 2015 The Evaluation of WBP2NL-Related Genes Expression in Breast Cancer.
25056061 2014 Biological insights from 108 schizophrenia-associated genetic loci.
24907910 2014 Sperm content of postacrosomal WW binding protein is related to fertilization outcomes in patients undergoing assisted reproductive technology.
24528284 2014 Citalopram and escitalopram plasma drug and metabolite concentrations: genome-wide associations.
17289678 2007 PAWP, a sperm-specific WW domain-binding protein, promotes meiotic resumption and pronuclear development during fertilization.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15461802 2004 A genome annotation-driven approach to cloning the human ORFeome.
More...