Property Summary

NCBI Gene PubMed Count 11
PubMed Score 3.86
PubTator Score 2.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
tuberculosis 1563 3.34871807498673E-7
ovarian cancer 8492 4.2741694565594E-7
atypical teratoid/rhabdoid tumor 1095 1.19687167099415E-6
osteosarcoma 7933 9.06714977463708E-5
glioblastoma 5572 5.29853440065608E-4
cystic fibrosis 1670 6.90286713664528E-4
medulloblastoma, large-cell 6234 0.00441523735303406
gastric carcinoma 832 0.00608974278077078
Waldenstrons macroglobulinemia 765 0.00699157640210291
astrocytic glioma 2241 0.0170913242006487
ependymoma 2514 0.0208473430892742
oligodendroglioma 2849 0.0328763593978311

Expression

  Differential Expression (12)

Disease log2 FC p
Waldenstrons macroglobulinemia 1.065 0.007
astrocytic glioma -1.200 0.017
ependymoma -1.800 0.021
oligodendroglioma -1.200 0.033
osteosarcoma -1.753 0.000
atypical teratoid/rhabdoid tumor -1.600 0.000
glioblastoma -1.100 0.001
medulloblastoma, large-cell -1.200 0.004
tuberculosis 1.500 0.000
cystic fibrosis 1.100 0.001
gastric carcinoma 1.700 0.006
ovarian cancer 2.600 0.000

Synonym

Accession Q6ICG6 B0QY17 B0QY19 B3KT48 Q6ZVE5 Q7Z6K9 Q8IZ76 Q9Y2E2
Symbols LSC3
C22orf9

Gene

  Ortholog (13)

AA Sequence

MLRAIAEERGRLSLRREVCGLGCFKDDRIVFWTWMFSTYFMEKWAPRQDDMLFYVRRKLAYSGSESGADG      1 - 70
RKAAEPEVEVEVYRRDSKKLPGLGDPDIDWEESVCLNLILQKLDYMVTCAVCTRADGGDIHIHKKKSQQV     71 - 140
FASPSKHPMDSKGEESKISYPNIFFMIDSFEEVFSDMTVGEGEMVCVELVASDKTNTFQGVIFQGSIRYE    141 - 210
ALKKVYDNRVSVAARMAQKMSFGFYKYSNMEFVRMKGPQGKGHAEMAVSRVSTGDTSPCGTEEDSSPASP    211 - 280
MHERVTSFSTPPTPERNNRPAFFSPSLKRKVPRNRIAEMKKSHSANDSEEFFREDDGGADLHNATNLRSR    281 - 350
SLSGTGRSLVGSWLKLNRADGNFLLYAHLTYVTLPLHRILTDILEVRQKPILMT                    351 - 404
//

Text Mined References (17)

PMID Year Title
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24255178 2013 Protein interaction network of the mammalian Hippo pathway reveals mechanisms of kinase-phosphatase interactions.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15461802 2004 A genome annotation-driven approach to cloning the human ORFeome.
More...