Property Summary

NCBI Gene PubMed Count 9
PubMed Score 0.17
PubTator Score 0.14

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (2)

Disease Z-score Confidence
Meningioma 26 3.04 1.5
cystic fibrosis 1,665

Expression

  Differential Expression (1)

Disease log2 FC p
cystic fibrosis 2.784 0.000

Synonym

Accession Q6ICB4 Q3SXQ3 Q8N6L9 Ses2
Symbols Ses2
IPIP27B

Gene

Gene RIF (2)

PMID Text
21233288 Two novel OCRL1-binding proteins, termed inositol polyphosphate phosphatase interacting protein of 27 kDa (IPIP27)A and B (also known as Ses1 and 2), that also bind the related 5-phosphatase Inpp5b, were identified.
20133602 Two closely related endocytic proteins, Ses1 and Ses2, which interact with OCRL, were identified. The interaction is mediated by a short amino acid motif similar to that used by the rab-5 effector APPL1.

AA Sequence

MKLNERSVAHYALSDSPADHMGFLRTWGGPGTPPTPSGTGRRCWFVLKGNLLFSFESREGRAPLSLVVLE      1 - 70
GCTVELAEAPVPEEFAFAICFDAPGVRPHLLAAEGPAAQEAWVKVLSRASFGYMRLVVRELESQLQDARQ     71 - 140
SLALQRRSSWKSVASRCKPQAPNHRAAGLENGHCLSKDSSPVGLVEEAGSRSAGWGLAEWELQGPASLLL    141 - 210
GKGQSPVSPETSCFSTLHDWYGQEIVELRQCWQKRAQGSHSKCEEQDRP                         211 - 259
//

Text Mined References (9)

PMID Year Title
27107012 2016 Pooled-matrix protein interaction screens using Barcode Fusion Genetics.
25056061 2014 Biological insights from 108 schizophrenia-associated genetic loci.
21233288 2011 The PH domain proteins IPIP27A and B link OCRL1 to receptor recycling in the endocytic pathway.
20133602 2010 Two closely related endocytic proteins that share a common OCRL-binding motif with APPL1.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15461802 2004 A genome annotation-driven approach to cloning the human ORFeome.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10591208 1999 The DNA sequence of human chromosome 22.