Property Summary

NCBI Gene PubMed Count 9
PubMed Score 0.17
PubTator Score 0.14

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
cystic fibrosis 1670 6.30122677187261E-6
Disease Target Count Z-score Confidence
Meningioma 27 3.04 1.5

Expression

  Differential Expression (1)

Disease log2 FC p
cystic fibrosis 2.784 0.000

Synonym

Accession Q6ICB4 Q3SXQ3 Q8N6L9 Ses2
Symbols Ses2
IPIP27B

Gene

  Ortholog (7)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid
Platypus EggNOG Inparanoid

Gene RIF (2)

PMID Text
21233288 Two novel OCRL1-binding proteins, termed inositol polyphosphate phosphatase interacting protein of 27 kDa (IPIP27)A and B (also known as Ses1 and 2), that also bind the related 5-phosphatase Inpp5b, were identified.
20133602 Two closely related endocytic proteins, Ses1 and Ses2, which interact with OCRL, were identified. The interaction is mediated by a short amino acid motif similar to that used by the rab-5 effector APPL1.

AA Sequence

MKLNERSVAHYALSDSPADHMGFLRTWGGPGTPPTPSGTGRRCWFVLKGNLLFSFESREGRAPLSLVVLE      1 - 70
GCTVELAEAPVPEEFAFAICFDAPGVRPHLLAAEGPAAQEAWVKVLSRASFGYMRLVVRELESQLQDARQ     71 - 140
SLALQRRSSWKSVASRCKPQAPNHRAAGLENGHCLSKDSSPVGLVEEAGSRSAGWGLAEWELQGPASLLL    141 - 210
GKGQSPVSPETSCFSTLHDWYGQEIVELRQCWQKRAQGSHSKCEEQDRP                         211 - 259
//

Text Mined References (9)

PMID Year Title
27107012 2016 Pooled-matrix protein interaction screens using Barcode Fusion Genetics.
25056061 2014 Biological insights from 108 schizophrenia-associated genetic loci.
21233288 2011 The PH domain proteins IPIP27A and B link OCRL1 to receptor recycling in the endocytic pathway.
20133602 2010 Two closely related endocytic proteins that share a common OCRL-binding motif with APPL1.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15461802 2004 A genome annotation-driven approach to cloning the human ORFeome.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10591208 1999 The DNA sequence of human chromosome 22.