Property Summary

NCBI Gene PubMed Count 9
PubMed Score 0.17
PubTator Score 0.14

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
cystic fibrosis 1696 6.3e-06
Disease Target Count Z-score Confidence
Meningioma 41 3.037 1.5

Expression

  Differential Expression (1)

Disease log2 FC p
cystic fibrosis 2.784 6.3e-06

Gene RIF (2)

AA Sequence

MKLNERSVAHYALSDSPADHMGFLRTWGGPGTPPTPSGTGRRCWFVLKGNLLFSFESREGRAPLSLVVLE      1 - 70
GCTVELAEAPVPEEFAFAICFDAPGVRPHLLAAEGPAAQEAWVKVLSRASFGYMRLVVRELESQLQDARQ     71 - 140
SLALQRRSSWKSVASRCKPQAPNHRAAGLENGHCLSKDSSPVGLVEEAGSRSAGWGLAEWELQGPASLLL    141 - 210
GKGQSPVSPETSCFSTLHDWYGQEIVELRQCWQKRAQGSHSKCEEQDRP                         211 - 259
//

Text Mined References (9)

PMID Year Title