Property Summary

NCBI Gene PubMed Count 8
PubMed Score 0.83
PubTator Score 2.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
medulloblastoma 1524 1.32487255785935E-9
posterior fossa group A ependymoma 1511 1.7798457079263E-9
lung adenocarcinoma 2714 2.26721631891424E-9
atypical teratoid/rhabdoid tumor 1095 4.04122103375423E-9
pediatric high grade glioma 2712 9.61269329256865E-7
glioblastoma 5572 1.42096046239755E-5
osteosarcoma 7933 3.03635435634109E-5
psoriasis 6685 1.35081179083501E-4
pancreatic ductal adenocarcinoma liver metastasis 1795 0.00147562432363213
cutaneous lupus erythematosus 1056 0.0145362834979269

Expression

  Differential Expression (10)

Disease log2 FC p
cutaneous lupus erythematosus 1.100 0.015
psoriasis -1.500 0.000
osteosarcoma -1.314 0.000
medulloblastoma -1.400 0.000
atypical teratoid/rhabdoid tumor -1.500 0.000
glioblastoma -1.200 0.000
pancreatic ductal adenocarcinoma liver m... -1.544 0.001
pediatric high grade glioma -1.100 0.000
posterior fossa group A ependymoma -1.100 0.000
lung adenocarcinoma 1.500 0.000

Synonym

Accession Q6ICB0 DeSI-1
Symbols DESI2
DeSI-1
PPPDE2
FAM152B
D15Wsu75e
DJ347H13.4

Gene

PDB

3EBQ  

  Ortholog (13)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Horse OMA EggNOG Inparanoid
Cow OMA EggNOG
Opossum OMA EggNOG Inparanoid
Platypus OMA EggNOG
Chicken OMA EggNOG
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG
Zebrafish OMA EggNOG Inparanoid

Gene RIF (2)

PMID Text
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MEPPNLYPVKLYVYDLSKGLARRLSPIMLGKQLEGIWHTSIVVHKDEFFFGSGGISSCPPGGTLLGPPDS      1 - 70
VVDVGSTEVTEEIFLEYLSSLGESLFRGEAYNLFEHNCNTFSNEVAQFLTGRKIPSYITDLPSEVLSTPF     71 - 140
GQALRPLLDSIQIQPPGGSSVGRPNGQS                                              141 - 168
//

Text Mined References (12)

PMID Year Title
22370726 2012 DeSUMOylating isopeptidase: a second class of SUMO protease.
21269460 2011 Initial characterization of the human central proteome.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15461802 2004 A genome annotation-driven approach to cloning the human ORFeome.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10591208 1999 The DNA sequence of human chromosome 22.
More...