Property Summary

NCBI Gene PubMed Count 2
PubMed Score 0.07
PubTator Score 0.07

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (2)

Disease Z-score Confidence
pituitary cancer 1,972
psoriasis 6,685

Synonym

Accession Q6IC83 A4QPH5
Symbols dJ90G24.6

Gene

 Compartment GO Term (1)

AA Sequence

MGSKLTCCLGPSGGLNCDCCRPDVGPCHECEIPETVAATAPASTTAKPAKLDLKAKKAQLMQYLSLPKTP      1 - 70
KMLKMSKGLDARSKRWLKIIWRRHGIWPLENIGPTEDVQASAHGGVEENMTSDIEIPEAKHDHRPTEDVQ     71 - 140
VSAHGGVEENITSDIEISEAKHDHHLVEDLSESLSVCLEDFMTSDLSESLSVSLEDFMTSGLSESLSVSL    141 - 210
EDLMTPEMAKERYEDYLCWVKMARSRLNEPISSQVLGLLRL                                 211 - 251
//

Text Mined References (3)

PMID Year Title
15461802 2004 A genome annotation-driven approach to cloning the human ORFeome.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10591208 1999 The DNA sequence of human chromosome 22.