Property Summary

NCBI Gene PubMed Count 17
PubMed Score 4.53
PubTator Score 5.96

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
osteosarcoma 7,933

Expression

  Differential Expression (1)

Disease log2 FC p
osteosarcoma -1.674 0.000

Synonym

Gene

Gene RIF (5)

PMID Text
26742120 DNA methylation in the NCAPH2/LMF2 promoter region is significantly decreased in Alzheimer disease.
26017022 CAPH2 protein accumulates as cells approach senescence, and knockdown of CAPH2 inhibits senescence.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
14532007 The CAP-H2 subunit of the condensin II complex implicated in chromosome assembly and segregation

AA Sequence

MEDVEARFAHLLQPIRDLTKNWEVDVAAQLGEYLEELDQICISFDEGKTTMNFIEAALLIQGSACVYSKK      1 - 70
VEYLYSLVYQALDFISGKRRAKQLSSVQEDRANGVASSGVPQEAENEFLSLDDFPDSRTNVDLKNDQTPS     71 - 140
EVLIIPLLPMALVAPDEMEKNNNPLYSRQGEVLASRKDFRMNTCVPHPRGAFMLEPEGMSPMEPAGVSPM    141 - 210
PGTQKDTGRTEEQPMEVSVCRSPVPALGFSQEPGPSPEGPMPLGGGEDEDAEEAVELPEASAPKAALEPK    211 - 280
ESRSPQQSAALPRRYMLREREGAPEPASCVKETPDPWQSLDPFDSLESKPFKKGRPYSVPPCVEEALGQK    281 - 350
RKRKGAAKLQDFHQWYLAAYADHADSRRLRRKGPSFADMEVLYWTHVKEQLETLRKLQRREVAEQWLRPA    351 - 420
EEDHLEDSLEDLGAADDFLEPEEYMEPEGADPREAADLDAVPMSLSYEELVRRNVELFIATSQKFVQETE    421 - 490
LSQRIRDWEDTVQPLLQEQEQHVPFDIHTYGDQLVSRFPQLNEWCPFAELVAGQPAFEVCRSMLASLQLA    491 - 560
NDYTVEITQQPGLEMAVDTMSLRLLTHQRAHKRFQTYAAPSMAQP                             561 - 605
//

Text Mined References (29)

PMID Year Title
26742120 2016 Development of Biomarkers Based on DNA Methylation in the NCAPH2/LMF2 Promoter Region for Diagnosis of Alzheimer's Disease and Amnesic Mild Cognitive Impairment.
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
26017022 2015 A novel role for the condensin II complex in cellular senescence.
25416956 2014 A proteome-scale map of the human interactome network.
23222517 2012 Seventy-five genetic loci influencing the human red blood cell.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21269460 2011 Initial characterization of the human central proteome.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20442714 2010 Condensin and cohesin complexity: the expanding repertoire of functions.
20139978 2010 Genome-wide association study of hematological and biochemical traits in a Japanese population.
More...