Property Summary

NCBI Gene PubMed Count 22
PubMed Score 17.75
PubTator Score 6.95

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

Disease log2 FC p
acute quadriplegic myopathy -1.073 9.1e-04
group 4 medulloblastoma -1.100 3.7e-03
medulloblastoma, large-cell -1.200 1.5e-04
psoriasis 1.200 2.0e-04

Gene RIF (6)

AA Sequence

MAHQTGIHATEELKEFFAKARAGSVRLIKVVIEDEQLVLGASQEPVGRWDQDYDRAVLPLLDAQQPCYLL      1 - 70
YRLDSQNAQGFEWLFLAWSPDNSPVRLKMLYAATRATVKKEFGGGHIKDELFGTVKDDLSFAGYQKHLSS     71 - 140
CAAPAPLTSAERELQQIRINEVKTEISVESKHQTLQGLAFPLQPEAQRALQQLKQKMVNYIQMKLDLERE    141 - 210
TIELVHTEPTDVAQLPSRVPRDAARYHFFLYKHTHEGDPLESVVFIYSMPGYKCSIKERMLYSSCKSRLL    211 - 280
DSVEQDFHLEIAKKIEIGDGAELTAEFLYDEVHPKQHAFKQAFAKPKGPGGKRGHKRLIRGPGENGDDS     281 - 349
//

Text Mined References (29)

PMID Year Title