Property Summary

NCBI Gene PubMed Count 22
PubMed Score 16.58
PubTator Score 6.95

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
medulloblastoma, large-cell 6234 1.47997154611268E-4
psoriasis 6685 1.98659040860499E-4
acute quadriplegic myopathy 1157 9.09508531772654E-4
group 4 medulloblastoma 1875 0.00371985402890718
Disease Target Count Z-score Confidence
Monkeypox 10 4.928 2.5
Cowpox 15 4.454 2.2
Specific language impairment 31 4.289 2.1

Expression

  Differential Expression (4)

Disease log2 FC p
psoriasis 1.200 0.000
medulloblastoma, large-cell -1.200 0.000
acute quadriplegic myopathy -1.073 0.001
group 4 medulloblastoma -1.100 0.004

Synonym

Accession Q6IBS0 Q9Y3F5
Symbols A6r
A6RP
PTK9L
MSTP011

Gene

PDB

2VAC   2W0I  

  Ortholog (8)

Species Source
Mouse OMA Inparanoid
Opossum OMA Inparanoid
Platypus OMA Inparanoid
Chicken OMA Inparanoid
Anole lizard OMA EggNOG Inparanoid
C. elegans OMA EggNOG
Fruitfly OMA Inparanoid
S.cerevisiae OMA EggNOG

 MGI Term (1)

Pathway (1)

Gene RIF (6)

PMID Text
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20438785 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20406964 Observational study of gene-disease association. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
19423540 Observational study of gene-disease association. (HuGE Navigator)
17910947 twinfilin-2 is a protein that is involved in neurite outgrowth

AA Sequence

MAHQTGIHATEELKEFFAKARAGSVRLIKVVIEDEQLVLGASQEPVGRWDQDYDRAVLPLLDAQQPCYLL      1 - 70
YRLDSQNAQGFEWLFLAWSPDNSPVRLKMLYAATRATVKKEFGGGHIKDELFGTVKDDLSFAGYQKHLSS     71 - 140
CAAPAPLTSAERELQQIRINEVKTEISVESKHQTLQGLAFPLQPEAQRALQQLKQKMVNYIQMKLDLERE    141 - 210
TIELVHTEPTDVAQLPSRVPRDAARYHFFLYKHTHEGDPLESVVFIYSMPGYKCSIKERMLYSSCKSRLL    211 - 280
DSVEQDFHLEIAKKIEIGDGAELTAEFLYDEVHPKQHAFKQAFAKPKGPGGKRGHKRLIRGPGENGDDS     281 - 349
//

Text Mined References (29)

PMID Year Title
25468996 2014 E-cadherin interactome complexity and robustness resolved by quantitative proteomics.
23974872 2013 Genome-wide association analysis identifies 13 new risk loci for schizophrenia.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
21926972 2011 Large-scale genome-wide association analysis of bipolar disorder identifies a new susceptibility locus near ODZ4.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
21044950 2011 Genome-wide YFP fluorescence complementation screen identifies new regulators for telomere signaling in human cells.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20438785 2010 Polymorphisms in innate immunity genes and risk of childhood leukemia.
More...