Property Summary

NCBI Gene PubMed Count 20
Grant Count 7
R01 Count 2
Funding $2,819,433.2
PubMed Score 71.51
PubTator Score 396.46

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
nephrosclerosis -2.029 0.003
medulloblastoma, large-cell 1.100 0.000
pancreatic ductal adenocarcinoma liver m... -1.077 0.004
breast carcinoma -1.400 0.001
fibroadenoma -1.800 0.032
ductal carcinoma in situ -3.500 0.000
invasive ductal carcinoma -3.600 0.001
ovarian cancer 1.100 0.000

Gene RIF (8)

PMID Text
26149650 Data indicate that Afrikaner caucasians have a Q61L single nucleotide polymorphism (SNP) occurring at a high frequency (12%).
23237781 SNP variations causing amino acid substitutions in the human GLYAT gene influence the kinetic properties of the enzyme.
23108985 We identify GLYAT gene which appears to co-regulate bone size phenotypes (BSPs) and appendicular lean mass (ALM).
22475485 hGLYAT is a good candidate as a novel marker of hepatocellular carcinoma and may be a key molecule in the transition between differentiation and carcinogenesis of liver cells.
20925583 The aim of this work was to report a comprehensive investigation of GLYAT genetic polymorphisms in DNA samples from 55 subjects of French Caucasian origin.
20925583 Observational study of genotype prevalence. (HuGE Navigator)
20877624 Observational study of gene-disease association. (HuGE Navigator)
19252341 Observational study of genotype prevalence. (HuGE Navigator)

AA Sequence

MMLPLQGAQMLQMLEKSLRKSLPASLKVYGTVFHINHGNPFNLKAVVDKWPDFNTVVVCPQEQDMTDDLD      1 - 70
HYTNTYQIYSKDPQNCQEFLGSPELINWKQHLQIQSSQPSLNEAIQNLAAIKSFKVKQTQRILYMAAETA     71 - 140
KELTPFLLKSKILSPNGGKPKAINQEMFKLSSMDVTHAHLVNKFWHFGGNERSQRFIERCIQTFPTCCLL    141 - 210
GPEGTPVCWDLMDQTGEMRMAGTLPEYRLHGLVTYVIYSHAQKLGKLGFPVYSHVDYSNEAMQKMSYTLQ    211 - 280
HVPIPRSWNQWNCVPL                                                          281 - 296
//

Text Mined References (22)

PMID Year Title
26149650 2015 Conservation of the coding regions of the glycine N-acyltransferase gene further suggests that glycine conjugation is an essential detoxification pathway.
25416956 2014 A proteome-scale map of the human interactome network.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23237781 2013 Characterisation of the influence of genetic variations on the enzyme activity of a recombinant human glycine N-acyltransferase.
23108985 2013 Suggestion of GLYAT gene underlying variation of bone size and body lean mass as revealed by a bivariate genome-wide association study.
22475485 2012 Designation of enzyme activity of glycine-N-acyltransferase family genes and depression of glycine-N-acyltransferase in human hepatocellular carcinoma.
20925583 2010 Genetic polymorphisms of glycine N-acyltransferase (GLYAT) in a French Caucasian population.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
19252341 2009 Genetic polymorphisms of glycine N-acyltransferase in Japanese individuals.
More...