Property Summary

NCBI Gene PubMed Count 21
PubMed Score 76.44
PubTator Score 396.46

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
breast carcinoma -1.400 9.8e-04
ductal carcinoma in situ -3.500 1.1e-04
fibroadenoma -1.800 3.2e-02
invasive ductal carcinoma -3.600 1.3e-03
medulloblastoma, large-cell 1.100 2.2e-04
nephrosclerosis -2.029 2.7e-03
ovarian cancer 1.100 1.0e-09
pancreatic ductal adenocarcinoma liver m... -1.077 3.8e-03

Gene RIF (9)

AA Sequence

MMLPLQGAQMLQMLEKSLRKSLPASLKVYGTVFHINHGNPFNLKAVVDKWPDFNTVVVCPQEQDMTDDLD      1 - 70
HYTNTYQIYSKDPQNCQEFLGSPELINWKQHLQIQSSQPSLNEAIQNLAAIKSFKVKQTQRILYMAAETA     71 - 140
KELTPFLLKSKILSPNGGKPKAINQEMFKLSSMDVTHAHLVNKFWHFGGNERSQRFIERCIQTFPTCCLL    141 - 210
GPEGTPVCWDLMDQTGEMRMAGTLPEYRLHGLVTYVIYSHAQKLGKLGFPVYSHVDYSNEAMQKMSYTLQ    211 - 280
HVPIPRSWNQWNCVPL                                                          281 - 296
//

Text Mined References (23)

PMID Year Title