Property Summary

NCBI Gene PubMed Count 20
PubMed Score 71.51
PubTator Score 396.46

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (3)

Disease Target Count P-value
ovarian cancer 8492 1.02384472992833E-9
ductal carcinoma in situ 1745 1.1337684798097E-4
medulloblastoma, large-cell 6234 2.16008373280827E-4
breast carcinoma 1614 9.78937565313637E-4
invasive ductal carcinoma 2950 0.00130096462077972
nephrosclerosis 329 0.00267620751460518
pancreatic ductal adenocarcinoma liver metastasis 1795 0.00377017272414423
fibroadenoma 557 0.0316344349947688
Disease Target Count Z-score Confidence
Osteoporosis 259 0.0 2.0

Expression

  Differential Expression (8)

Disease log2 FC p
nephrosclerosis -2.029 0.003
medulloblastoma, large-cell 1.100 0.000
pancreatic ductal adenocarcinoma liver m... -1.077 0.004
breast carcinoma -1.400 0.001
fibroadenoma -1.800 0.032
ductal carcinoma in situ -3.500 0.000
invasive ductal carcinoma -3.600 0.001
ovarian cancer 1.100 0.000

Synonym

Accession Q6IB77 O14833 Q96QK7
Symbols CAT
GAT
ACGNAT

Gene

PANTHER Protein Class (1)

  Ortholog (7)

Gene RIF (8)

PMID Text
26149650 Data indicate that Afrikaner caucasians have a Q61L single nucleotide polymorphism (SNP) occurring at a high frequency (12%).
23237781 SNP variations causing amino acid substitutions in the human GLYAT gene influence the kinetic properties of the enzyme.
23108985 We identify GLYAT gene which appears to co-regulate bone size phenotypes (BSPs) and appendicular lean mass (ALM).
22475485 hGLYAT is a good candidate as a novel marker of hepatocellular carcinoma and may be a key molecule in the transition between differentiation and carcinogenesis of liver cells.
20925583 The aim of this work was to report a comprehensive investigation of GLYAT genetic polymorphisms in DNA samples from 55 subjects of French Caucasian origin.
20925583 Observational study of genotype prevalence. (HuGE Navigator)
20877624 Observational study of gene-disease association. (HuGE Navigator)
19252341 Observational study of genotype prevalence. (HuGE Navigator)

AA Sequence

MMLPLQGAQMLQMLEKSLRKSLPASLKVYGTVFHINHGNPFNLKAVVDKWPDFNTVVVCPQEQDMTDDLD      1 - 70
HYTNTYQIYSKDPQNCQEFLGSPELINWKQHLQIQSSQPSLNEAIQNLAAIKSFKVKQTQRILYMAAETA     71 - 140
KELTPFLLKSKILSPNGGKPKAINQEMFKLSSMDVTHAHLVNKFWHFGGNERSQRFIERCIQTFPTCCLL    141 - 210
GPEGTPVCWDLMDQTGEMRMAGTLPEYRLHGLVTYVIYSHAQKLGKLGFPVYSHVDYSNEAMQKMSYTLQ    211 - 280
HVPIPRSWNQWNCVPL                                                          281 - 296
//

Text Mined References (22)

PMID Year Title
26149650 2015 Conservation of the coding regions of the glycine N-acyltransferase gene further suggests that glycine conjugation is an essential detoxification pathway.
25416956 2014 A proteome-scale map of the human interactome network.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23237781 2013 Characterisation of the influence of genetic variations on the enzyme activity of a recombinant human glycine N-acyltransferase.
23108985 2013 Suggestion of GLYAT gene underlying variation of bone size and body lean mass as revealed by a bivariate genome-wide association study.
22475485 2012 Designation of enzyme activity of glycine-N-acyltransferase family genes and depression of glycine-N-acyltransferase in human hepatocellular carcinoma.
20925583 2010 Genetic polymorphisms of glycine N-acyltransferase (GLYAT) in a French Caucasian population.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
19252341 2009 Genetic polymorphisms of glycine N-acyltransferase in Japanese individuals.
More...