Property Summary

NCBI Gene PubMed Count 9
PubMed Score 0.25

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
cystic fibrosis 1696 2.2e-06
ovarian cancer 8520 2.9e-06

Expression

  Differential Expression (2)

Disease log2 FC p
cystic fibrosis -1.625 2.2e-06
ovarian cancer 1.500 2.9e-06

AA Sequence

MVSPATRKSLPKVKAMDFITSTAILPLLFGCLGVFGLFRLLQWVRGKAYLRNAVVVITGATSGLGKECAK      1 - 70
VFYAAGAKLVLCGRNGGALEELIRELTASHATKVQTHKPYLVTFDLTDSGAIVAAAAEILQCFGYVDILV     71 - 140
NNAGISYRGTIMDTTVDVDKRVMETNYFGPVALTKALLPSMIKRRQGHIVAISSIQGKMSIPFRSAYAAS    141 - 210
KHATQAFFDCLRAEMEQYEIEVTVISPGYIHTNLSVNAITADGSRYGVMDTTTAQGRSPVEVAQDVLAAV    211 - 280
GKKKKDVILADLLPSLAVYLRTLAPGLFFSLMASRARKERKSKNS                             281 - 325
//

Text Mined References (13)

PMID Year Title