Property Summary

NCBI Gene PubMed Count 18
Grant Count 1
R01 Count 1
Funding $103,180.5
PubMed Score 9.24
PubTator Score 5.71

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (2)

Disease log2 FC p
primary pancreatic ductal adenocarcinoma 1.386 0.001
pancreatic cancer 1.300 0.001

Synonym

Accession Q6IAA8 Q8WZ09 Q9NWT0
Symbols p18
PDRO
C11orf59
p27RF-Rho
Ragulator1

Gene

 Grant Application (1)

Gene RIF (6)

PMID Text
26032166 Data suggest that ablation of p18/LAMTOR1 suppresses starvation-induced cell death by stimulating autophagy through modulation of p27(kip1) activity.
22513874 LAMTOR1 expression affects the tuning of lysosomal activation that can lead to p53-dependent apoptosis through excessive catabolism.
21087931 A p27(kip1)-binding protein, p27RF-Rho, promotes cancer metastasis via activation of RhoA and RhoC.
20381137 A complex encoded by the MAPKSP1, ROBLD3, and c11orf59 genes interacts with the Rag GTPases, recruits them to lysosomes, and is essential for mTORC1 activation
19654316 MT1-MMP-associated protein p27RF-Rho binds p27(kip1) and prevents p27(kip1) from binding to RhoA. [p27RF-Rho]
19177150 Studies in rat and mice, identified the rat p18 protein as an endosomal membrane anchoring protein which interacts with MEK1 scaffold p14/MP1 and mobilizes them to late endosome.

AA Sequence

MGCCYSSENEDSDQDREERKLLLDPSSPPTKALNGAEPNYHSLPSARTDEQALLSSILAKTASNIIDVSA      1 - 70
ADSQGMEQHEYMDRARQYSTRLAVLSSSLTHWKKLPPLPSLTSQPHQVLASEPIPFSDLQQVSRIAAYAY     71 - 140
SALSQIRVDAKEELVVQFGIP                                                     141 - 161
//

Text Mined References (30)

PMID Year Title
26032166 2015 Depletion of p18/LAMTOR1 promotes cell survival via activation of p27(kip1) -dependent autophagy under starvation.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25807930 2015 Multifunctional reagents for quantitative proteome-wide analysis of protein modification in human cells and dynamic profiling of protein lipidation during vertebrate development.
25567906 2015 Metabolism. Lysosomal amino acid transporter SLC38A9 signals arginine sufficiency to mTORC1.
25561175 2015 SLC38A9 is a component of the lysosomal amino acid sensing machinery that controls mTORC1.
25255805 2014 Global profiling of co- and post-translationally N-myristoylated proteomes in human cells.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22980980 2012 Ragulator is a GEF for the rag GTPases that signal amino acid levels to mTORC1.
More...