Property Summary

NCBI Gene PubMed Count 24
PubMed Score 13.88
PubTator Score 5.71

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (2)

Disease log2 FC p
pancreatic cancer 1.300 6.3e-04
pancreatic ductal adenocarcinoma liver m... -1.091 3.9e-02

 GO Function (1)

Gene RIF (10)

AA Sequence

MGCCYSSENEDSDQDREERKLLLDPSSPPTKALNGAEPNYHSLPSARTDEQALLSSILAKTASNIIDVSA      1 - 70
ADSQGMEQHEYMDRARQYSTRLAVLSSSLTHWKKLPPLPSLTSQPHQVLASEPIPFSDLQQVSRIAAYAY     71 - 140
SALSQIRVDAKEELVVQFGIP                                                     141 - 161
//

Text Mined References (35)

PMID Year Title