Property Summary

NCBI Gene PubMed Count 12
PubMed Score 19.80
PubTator Score 29.29

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (3)

Disease Target Count
Intellectual disability 573
Disease Target Count P-value
osteosarcoma 7933 1.17316382607213E-10
ovarian cancer 8492 3.17306978848231E-10
glioblastoma 5572 9.80892697734291E-5
pediatric high grade glioma 2712 1.63287550066535E-4
atypical teratoid / rhabdoid tumor 4369 9.49597432980212E-4
medulloblastoma, large-cell 6234 0.00197727435095433
group 4 medulloblastoma 1875 0.00251942755266981

Expression

  Differential Expression (7)

Disease log2 FC p
osteosarcoma -2.196 0.000
atypical teratoid / rhabdoid tumor -1.100 0.001
glioblastoma -1.700 0.000
medulloblastoma, large-cell 1.100 0.002
pediatric high grade glioma -1.300 0.000
group 4 medulloblastoma 1.500 0.003
ovarian cancer -3.100 0.000

Gene RIF (3)

PMID Text
25847581 ELP2 mutation is implicated in severe intellectual disability, spastic diplegia, and self-injurious behavior described in two brothers.
25417721 Studied the possible relationship between STATIP1, STAT3 and CML resistance.
22069317 Elp2 and STAT-3 mediate, at least in part, the stimulation of Hsp70 expression by 4PBA.

AA Sequence

MVAPVLETSHVFCCPNRVRGVLNWSSGPRGLLAFGTSCSVVLYDPLKRVVVTNLNGHTARVNCIQWICKQ      1 - 70
DGSPSTELVSGGSDNQVIHWEIEDNQLLKAVHLQGHEGPVYAVHAVYQRRTSDPALCTLIVSAAADSAVR     71 - 140
LWSKKGPEVMCLQTLNFGNGFALALCLSFLPNTDVPILACGNDDCRIHIFAQQNDQFQKVLSLCGHEDWI    141 - 210
RGVEWAAFGRDLFLASCSQDCLIRIWKLYIKSTSLETQDDDNIRLKENTFTIENESVKIAFAVTLETVLA    211 - 280
GHENWVNAVHWQPVFYKDGVLQQPVRLLSASMDKTMILWAPDEESGVWLEQVRVGEVGGNTLGFYDCQFN    281 - 350
EDGSMIIAHAFHGALHLWKQNTVNPREWTPEIVISGHFDGVQDLVWDPEGEFIITVGTDQTTRLFAPWKR    351 - 420
KDQSQVTWHEIARPQIHGYDLKCLAMINRFQFVSGADEKVLRVFSAPRNFVENFCAITGQSLNHVLCNQD    421 - 490
SDLPEGATVPALGLSNKAVFQGDIASQPSDEEELLTSTGFEYQQVAFQPSILTEPPTEDHLLQNTLWPEV    491 - 560
QKLYGHGYEIFCVTCNSSKTLLASACKAAKKEHAAIILWNTTSWKQVQNLVFHSLTVTQMAFSPNEKFLL    561 - 630
AVSRDRTWSLWKKQDTISPEFEPVFSLFAFTNKITSVHSRIIWSCDWSPDSKYFFTGSRDKKVVVWGECD    631 - 700
STDDCIEHNIGPCSSVLDVGGAVTAVSVCPVLHPSQRYVVAVGLECGKICLYTWKKTDQVPEINDWTHCV    701 - 770
ETSQSQSHTLAIRKLCWKNCSGKTEQKEAEGAEWLHFASCGEDHTVKIHRVNKCAL                  771 - 826
//

Text Mined References (13)

PMID Year Title
25847581 2015 ELP2 is a novel gene implicated in neurodevelopmental disabilities.
25417721 2014 Inhibition of STAT3-interacting protein 1 (STATIP1) promotes STAT3 transcriptional up-regulation and imatinib mesylate resistance in the chronic myeloid leukemia.
22854966 2012 DERP6 (ELP5) and C3ORF75 (ELP6) regulate tumorigenicity and migration of melanoma cells as subunits of Elongator.
22069317 2011 4-Phenylbutyrate stimulates Hsp70 expression through the Elp2 component of elongator and STAT-3 in cystic fibrosis epithelial cells.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
16177791 2005 DNA sequence and analysis of human chromosome 18.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11818576 2002 Human Elongator facilitates RNA polymerase II transcription through chromatin.
11714725 2002 Purification and characterization of the human elongator complex.
10954736 2000 A Stat3-interacting protein (StIP1) regulates cytokine signal transduction.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.