Property Summary

NCBI Gene PubMed Count 33
Grant Count 34
R01 Count 23
Funding $4,366,808.96
PubMed Score 64.81
PubTator Score 24.54

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
astrocytic glioma -1.400 0.016
ependymoma -1.300 0.037
psoriasis -1.600 0.000
osteosarcoma -2.265 0.000
glioblastoma -1.200 0.001
group 4 medulloblastoma -1.900 0.000
medulloblastoma, large-cell -1.800 0.000
adult high grade glioma -1.600 0.001
ovarian cancer 1.700 0.000

Gene RIF (24)

PMID Text
26634342 SIGIRR plays an important role in the negative regulation of LPS response and tolerance in human bladder epithelial cells, possibly through its impact on TLR-mediated signaling.
26561030 Tir8/SIGIRR acts anti-inflammatory on different immune responses,its function in allergic asthma is a controversial issue, since anti- as well as pro-inflammatory effects have been reported
26344417 SIGIRR predicts biochemical recurrence in patients with low Gleason score and low pathological stage prostate cancer.
26344057 Levels of SIGIRR are lower in human colorectal tumors, compared with nontumor tissues; tumors contain the dominant-negative isoform SIGIRR(DeltaE8).
25963006 To the best of our knowledge, this is one of the first reports of a phenotype associated with SIGIRR in humans. Our data provide novel mechanistic insight into the probable causation of necrotizing enterocolitis
25729923 IL-37 requires the receptors IL-18Ralpha and IL-1R8 to carry out its multifaceted anti-inflammatory program upon innate signal transduction.
25654981 IL-37 acts as an extracellular cytokine by binding to the IL-18 receptor but using the IL-1R8 for its anti-inflammatory properties.
25287661 decreased numbers of SIGIRR-positive CD4+ T cells in SLE patients and its correlation with SLEDAI score as well as the clinical data suggest that SIGIRR may be involved in the pathogenesis of SLE.
24826913 An association was found in the SIGIRR rs7396562 polymorphism and systemic lupus erythematosus susceptibility in a Chinese population.
24821721 Lipopolysaccharide decreases SIGIRR expression by suppressing specificity protein 1 Sp1 via the TLR4-p38 pathway in monocytes and neutrophils.
More...

AA Sequence

MPGVCDRAPDFLSPSEDQVLRPALGSSVALNCTAWVVSGPHCSLPSVQWLKDGLPLGIGGHYSLHEYSWV      1 - 70
KANLSEVLVSSVLGVNVTSTEVYGAFTCSIQNISFSSFTLQRAGPTSHVAAVLASLLVLLALLLAALLYV     71 - 140
KCRLNVLLWYQDAYGEVEINDGKLYDAYVSYSDCPEDRKFVNFILKPQLERRRGYKLFLDDRDLLPRAEP    141 - 210
SADLLVNLSRCRRLIVVLSDAFLSRAWCSHSFREGLCRLLELTRRPIFITFEGQRRDPAHPALRLLRQHR    211 - 280
HLVTLLLWRPGSVTPSSDFWKEVQLALPRKVQYRPVEGDPQTQLQDDKDPMLILRGRVPEGRALDSEVDP    281 - 350
DPEGDLGVRGPVFGEPSAPPHTSGVSLGESRSSEVDVSDLGSRNYSARTDFYCLVSKDDM              351 - 410
//

Text Mined References (35)

PMID Year Title
26634342 2015 SIGIRR participates in negative regulation of LPS response and tolerance in human bladder epithelial cells.
26561030 2015 Allergic airway inflammation: unravelling the relationship between IL-37, IL-18R? and Tir8/SIGIRR.
26344417 2015 SIGIRR/TIR8, an important regulator of TLR4 and IL-1R-mediated NF-?B activation, predicts biochemical recurrence after prostatectomy in low-grade prostate carcinomas.
26344057 2015 Human Colon Tumors Express a Dominant-Negative Form of SIGIRR That Promotes Inflammation and Colitis-Associated Colon Cancer in Mice.
25963006 2015 SIGIRR genetic variants in premature infants with necrotizing enterocolitis.
25729923 2015 IL-37 requires the receptors IL-18R? and IL-1R8 (SIGIRR) to carry out its multifaceted anti-inflammatory program upon innate signal transduction.
25654981 2015 Extracellular forms of IL-37 inhibit innate inflammation in vitro and in vivo but require the IL-1 family decoy receptor IL-1R8.
25287661 2015 The decreased frequency of SIGIRR-positive CD4+ T cells in peripheral blood of patients with SLE and its correlation with disease activity.
24826913 2014 Emerging role of SIGIRR rs7396562(T/G) polymorphism in systemic lupus erythematosus in a Chinese population.
24821721 2014 Lipopolysaccharide decreases single immunoglobulin interleukin-1 receptor-related molecule (SIGIRR) expression by suppressing specificity protein 1 (Sp1) via the Toll-like receptor 4 (TLR4)-p38 pathway in monocytes and neutrophils.
More...