Property Summary

NCBI Gene PubMed Count 16
PubMed Score 2.04
PubTator Score 2.27

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Expression

  Differential Expression (7)

Disease log2 FC p
astrocytic glioma -1.300 2.6e-02
Breast cancer 1.800 4.8e-02
diabetes mellitus -1.100 1.0e-03
hereditary spastic paraplegia -1.032 3.5e-03
Multiple myeloma 1.653 4.3e-04
psoriasis 1.200 4.4e-04
Waldenstrons macroglobulinemia 1.332 1.4e-02

 GO Function (1)

 GWAS Trait (1)

Gene RIF (2)

AA Sequence

MGAVTDDEVIRKRLLIDGDGAGDDRRINLLVKSFIKWCNSGSQEEGYSQYQRMLSTLSQCEFSMGKTLLV      1 - 70
YDMNLREMENYEKIYKEIECSIAGAHEKIAECKKQILQAKRIRKNRQEYDALAKVIQHHPDRHETLKELE     71 - 140
ALGKELEHLSHIKESVEDKLELRRKQFHVLLSTIHELQQTLENDEKLSEVEEAQEASMETDPKP          141 - 204
//

Text Mined References (25)

PMID Year Title