Property Summary

NCBI Gene PubMed Count 16
PubMed Score 2.04
PubTator Score 2.27

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count
Schizophrenia 503
Disease Target Count P-value
Multiple myeloma 1328 4.31478510407246E-4
psoriasis 6685 4.37176461221941E-4
diabetes mellitus 1663 0.00104821351867176
hereditary spastic paraplegia 313 0.00345830168496636
Waldenstrons macroglobulinemia 765 0.0135809793145851
astrocytic glioma 2241 0.0261928110545765
Breast cancer 3099 0.0476579925142294

Expression

  Differential Expression (7)

Disease log2 FC p
Waldenstrons macroglobulinemia 1.332 0.014
Multiple myeloma 1.653 0.000
astrocytic glioma -1.300 0.026
psoriasis 1.200 0.000
hereditary spastic paraplegia -1.032 0.003
diabetes mellitus -1.100 0.001
Breast cancer 1.800 0.048

Synonym

Accession Q6I9Y2 Q6P1L3 Q8WUF2 Q9H5H0
Symbols fSAP24
hTREX30
NIF3L1BP1

Gene

  Ortholog (12)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid
Platypus OMA EggNOG
Chicken OMA EggNOG Inparanoid
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG Inparanoid
C. elegans OMA EggNOG
Fruitfly OMA Inparanoid

 GWAS Trait (1)

Gene RIF (2)

PMID Text
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19059247 THOC7 (50-137, amino acid numbers) binds to the N-terminal portion (1-199) of FMIP directly.

AA Sequence

MGAVTDDEVIRKRLLIDGDGAGDDRRINLLVKSFIKWCNSGSQEEGYSQYQRMLSTLSQCEFSMGKTLLV      1 - 70
YDMNLREMENYEKIYKEIECSIAGAHEKIAECKKQILQAKRIRKNRQEYDALAKVIQHHPDRHETLKELE     71 - 140
ALGKELEHLSHIKESVEDKLELRRKQFHVLLSTIHELQQTLENDEKLSEVEEAQEASMETDPKP          141 - 204
//

Text Mined References (24)

PMID Year Title
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
25056061 2014 Biological insights from 108 schizophrenia-associated genetic loci.
24270157 2013 A quantitative telomeric chromatin isolation protocol identifies different telomeric states.
23222130 2013 Aly and THO are required for assembly of the human TREX complex and association of TREX components with the spliced mRNA.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21269460 2011 Initial characterization of the human central proteome.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
19059247 2009 Nuclear localization of the pre-mRNA associating protein THOC7 depends upon its direct interaction with Fms tyrosine kinase interacting protein (FMIP).
More...