Property Summary

NCBI Gene PubMed Count 12
PubMed Score 1.35
PubTator Score 1.70

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
active Crohn's disease -1.092 7.1e-03
acute quadriplegic myopathy 1.368 8.7e-05
adult high grade glioma -1.900 5.0e-05
astrocytic glioma -1.800 1.8e-03
Astrocytoma, Pilocytic -2.400 1.2e-10
atypical teratoid / rhabdoid tumor -2.500 1.1e-07
ependymoma -1.900 1.8e-03
glioblastoma -1.900 1.0e-09
group 3 medulloblastoma -2.800 1.3e-05
lung carcinoma 1.600 1.5e-32
medulloblastoma, large-cell 1.100 1.2e-03
oligodendroglioma -1.400 1.9e-02
ovarian cancer 1.300 2.6e-10
primitive neuroectodermal tumor -1.900 1.1e-04
subependymal giant cell astrocytoma -2.145 2.6e-02

Gene RIF (1)

AA Sequence

MSAVSQPQAAPSPLEKSPSTAILCNTCGNVCKGEVLRVQDKYFHIKCFVCKACGCDLAEGGFFVRQGEYI      1 - 70
CTLDYQRLYGTRCFSCDQFIEGEVVSALGKTYHPDCFVCAVCRLPFPPGDRVTFNGKECMCQKCSLPVSV     71 - 140
GSSAHLSQGLRSCGGCGTEIKNGQALVALDKHWHLGCFKCKSCGKLLNAEYISKDGLPYCEADYHAKFGI    141 - 210
RCDSCEKYITGRVLEAGEKHYHPSCALCVRCGQMFAEGEEMYLQGSSIWHPACRQAARTEDRNKETRTSS    211 - 280
ESIISVPASSTSGSPSRVIYAKLGGEILDYRDLAALPKSKAIYDIDRPDMISYSPYISHSAGDRQSYGEG    281 - 350
DQDDRSYKQCRTSSPSSTGSVSLGRYTPTSRSPQHYSRPGSESGRSTPSLSVLSDSKPPPSTYQQAPRHF    351 - 420
HVPDTGVKDNIYRKPPIYRQHAARRSDGEDGSLDQDNRKKSSWLMLKGDADTRTNSPDLDTQSLSHSSGT    421 - 490
DRDPLQRMAGDSFHSRFPYSKSDPLPGHGKNGLDQRNANLAPCGADPDASWGMREYKIYPYDSLIVTNRI    491 - 560
RVKLPKDVDRTRLERHLSPEEFQEVFGMSIEEFDRLALWKRNDLKKKALLF                       561 - 611
//

Text Mined References (17)

PMID Year Title