Property Summary

NCBI Gene PubMed Count 20
PubMed Score 5.37
PubTator Score 6.57

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
psoriasis 6,685

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis 2.000 0.000

Synonym

Accession Q6H3X3 Q6H3X2
Symbols ULBP5

Gene

Gene RIF (8)

PMID Text
25212604 Human anaplastic thyroid carcinoma cells are sensitive to NK cell-mediated lysis via ULBP2/5/6 and chemoattract NK cells.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20304922 RAET1G is regulated post-translationally to produce a GPI-anchored isoform
20219610 Observational study of genotype prevalence. (HuGE Navigator)
19688209 Observational study of genotype prevalence. (HuGE Navigator)
19424970 RAET1G, like ULBP2, appears broadly expressed, but exhibits a lower apparent avidity for NKG2D due to a mutation in the center of the MHC-like fold.
19223974 the expression patterns of ULBP5RAET1G are very similar to the well-characterised NKG2D ligand, MICA. However the two isoforms of ULBP5/RAET1G have very different cellular localisations that are likely to reflect unique functionality.
15240696 Binds the activating receptor NKG2D and the the human cytomegalovirus protein UL16.

AA Sequence

MAAAASPAFLLRLPLLLLLSSWCRTGLADPHSLCYDITVIPKFRPGPRWCAVQGQVDEKTFLHYDCGSKT      1 - 70
VTPVSPLGKKLNVTTAWKAQNPVLREVVDILTEQLLDIQLENYIPKEPLTLQARMSCEQKAEGHGSGSWQ     71 - 140
LSFDGQIFLLFDSENRMWTTVHPGARKMKEKWENDKDMTMSFHYISMGDCTGWLEDFLMGMDSTLEPSAG    141 - 210
APPTMSSGTAQPRATATTLILCCLLIMCLLICSRHSLTQSHGHHPQSLQPPPHPPLLHPTWLLRRVLWSD    211 - 280
SYQIAKRPLSGGHVTRVTLPIIGDDSHSLPCPLALYTINNGAARYSEPLQVSIS                    281 - 334
//

Text Mined References (21)

PMID Year Title
26041808 2015 NKG2D Receptor and Its Ligands in Host Defense.
25510288 2014 MICA/B and ULBP1 NKG2D ligands are independent predictors of good prognosis in cervical cancer.
25473094 2015 Immunohistochemical validation and expression profiling of NKG2D ligands in a wide spectrum of human epithelial neoplasms.
25212604 2014 Human anaplastic thyroid carcinoma cells are sensitive to NK cell-mediated lysis via ULBP2/5/6 and chemoattract NK cells.
23298206 2013 Regulation of ligands for the NKG2D activating receptor.
20522206 2010 Linkage disequilibrium of polymorphic RAET1 genes in Thais.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20304922 2010 Post-translational modification of the NKG2D ligand RAET1G leads to cell surface expression of a glycosylphosphatidylinositol-linked isoform.
20219610 2010 Single nucleotide polymorphism analysis of the NKG2D ligand cluster on the long arm of chromosome 6: Extensive polymorphisms and evidence of diversity between human populations.
19861434 2009 NKG2D ligand expression in human colorectal cancer reveals associations with prognosis and evidence for immunoediting.
More...