Tbio | Retinoic acid early transcript 1G protein |
Acts as a ligand for the KLRK1 receptor and mediates NK cell cytotoxicity via the receptor.
This gene encodes a member of the major histocompatibility complex (MHC) class I family of proteins. Although the encoded protein includes C-terminal transmembrane and cytoplasmic domains, proteolytic processing results in the removal of these domains and subsequent tethering to the plasma membrane by a glycosylphosphatidylinositol (GPI)-anchor. The encoded protein is one of several related ligands of the natural killer group 2, member D (NKG2D) receptor, which functions as an activating receptor in innate and adaptive immunity. This gene is present in a gene cluster on chromosome 6. [provided by RefSeq, Jul 2015]
This gene encodes a member of the major histocompatibility complex (MHC) class I family of proteins. Although the encoded protein includes C-terminal transmembrane and cytoplasmic domains, proteolytic processing results in the removal of these domains and subsequent tethering to the plasma membrane by a glycosylphosphatidylinositol (GPI)-anchor. The encoded protein is one of several related ligands of the natural killer group 2, member D (NKG2D) receptor, which functions as an activating receptor in innate and adaptive immunity. This gene is present in a gene cluster on chromosome 6. [provided by RefSeq, Jul 2015]
Comments
PMID | Text |
---|---|
25212604 | Human anaplastic thyroid carcinoma cells are sensitive to NK cell-mediated lysis via ULBP2/5/6 and chemoattract NK cells. |
20379614 | Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator) |
20304922 | RAET1G is regulated post-translationally to produce a GPI-anchored isoform |
20219610 | Observational study of genotype prevalence. (HuGE Navigator) |
19688209 | Observational study of genotype prevalence. (HuGE Navigator) |
19424970 | RAET1G, like ULBP2, appears broadly expressed, but exhibits a lower apparent avidity for NKG2D due to a mutation in the center of the MHC-like fold. |
19223974 | the expression patterns of ULBP5RAET1G are very similar to the well-characterised NKG2D ligand, MICA. However the two isoforms of ULBP5/RAET1G have very different cellular localisations that are likely to reflect unique functionality. |
15240696 | Binds the activating receptor NKG2D and the the human cytomegalovirus protein UL16. |
MAAAASPAFLLRLPLLLLLSSWCRTGLADPHSLCYDITVIPKFRPGPRWCAVQGQVDEKTFLHYDCGSKT 1 - 70 VTPVSPLGKKLNVTTAWKAQNPVLREVVDILTEQLLDIQLENYIPKEPLTLQARMSCEQKAEGHGSGSWQ 71 - 140 LSFDGQIFLLFDSENRMWTTVHPGARKMKEKWENDKDMTMSFHYISMGDCTGWLEDFLMGMDSTLEPSAG 141 - 210 APPTMSSGTAQPRATATTLILCCLLIMCLLICSRHSLTQSHGHHPQSLQPPPHPPLLHPTWLLRRVLWSD 211 - 280 SYQIAKRPLSGGHVTRVTLPIIGDDSHSLPCPLALYTINNGAARYSEPLQVSIS 281 - 334 //
PMID | Year | Title |
---|---|---|
26041808 | 2015 | NKG2D Receptor and Its Ligands in Host Defense. |
25510288 | 2014 | MICA/B and ULBP1 NKG2D ligands are independent predictors of good prognosis in cervical cancer. |
25473094 | 2015 | Immunohistochemical validation and expression profiling of NKG2D ligands in a wide spectrum of human epithelial neoplasms. |
25212604 | 2014 | Human anaplastic thyroid carcinoma cells are sensitive to NK cell-mediated lysis via ULBP2/5/6 and chemoattract NK cells. |
23298206 | 2013 | Regulation of ligands for the NKG2D activating receptor. |
20522206 | 2010 | Linkage disequilibrium of polymorphic RAET1 genes in Thais. |
20379614 | Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score. | |
20304922 | 2010 | Post-translational modification of the NKG2D ligand RAET1G leads to cell surface expression of a glycosylphosphatidylinositol-linked isoform. |
20219610 | 2010 | Single nucleotide polymorphism analysis of the NKG2D ligand cluster on the long arm of chromosome 6: Extensive polymorphisms and evidence of diversity between human populations. |
19861434 | 2009 | NKG2D ligand expression in human colorectal cancer reveals associations with prognosis and evidence for immunoediting. |
More... |