Property Summary

NCBI Gene PubMed Count 20
PubMed Score 5.67
PubTator Score 6.57

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
psoriasis 6694 2.2e-86

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis 2.000 2.2e-86

Gene RIF (9)

AA Sequence

MAAAASPAFLLRLPLLLLLSSWCRTGLADPHSLCYDITVIPKFRPGPRWCAVQGQVDEKTFLHYDCGSKT      1 - 70
VTPVSPLGKKLNVTTAWKAQNPVLREVVDILTEQLLDIQLENYIPKEPLTLQARMSCEQKAEGHGSGSWQ     71 - 140
LSFDGQIFLLFDSENRMWTTVHPGARKMKEKWENDKDMTMSFHYISMGDCTGWLEDFLMGMDSTLEPSAG    141 - 210
APPTMSSGTAQPRATATTLILCCLLIMCLLICSRHSLTQSHGHHPQSLQPPPHPPLLHPTWLLRRVLWSD    211 - 280
SYQIAKRPLSGGHVTRVTLPIIGDDSHSLPCPLALYTINNGAARYSEPLQVSIS                    281 - 334
//

Text Mined References (21)

PMID Year Title