Property Summary

NCBI Gene PubMed Count 56
Grant Count 25
R01 Count 9
Funding $5,739,623.49
PubMed Score 55.52
PubTator Score 64.54

Knowledge Summary

Patent

No data available

Expression

Gene RIF (32)

PMID Text
26721477 We suggest that LAIR1 and LAIR2 genetic variants are associated with regulation of gene expression and variable pemphigus foliaceus susceptibility, and show indirect association of LAIR2 differential mRNA expression with pemphigus foliaceus pathogenesis.
26700814 A LAIR1 insertion generates broadly reactive antibodies against malaria variant antigens;findings illustrate, with a biologically relevant example, a novel mechanism of antibody diversification by interchromosomal DNA transposition
25915125 The LAIR1-SHP-1-CAMK1-CREB pathway sustains the survival and self-renewal of AML stem cells.
25660999 These data suggest that LAIR-1 has a relevant impact on EOC progression and may be helpful for a better understanding of molecular pathogenesis of cancer.
25275127 HIV-1 Nef downregulates the cell surface expression of leukocyte-associated immunoglobulin-like receptor 1 (LAIR1, CD305)
25247291 C1q-mediated repression of human monocytes is regulated by LAIR-1
24750832 LAIR-1 may play an important role in immune imbalance in children with immune thrombocytopenia.
24585933 a novel pathway for the immunomodulatory functions of SP-D mediated via binding of its collagenous domains to LAIR-1.
24415628 LAIR1 expression is a reliable and inexpensive marker capable of independently predicting time to first treatment in newly diagnosed unselected patients with chronic lymphocytic leukemia.
24399813 The expression of LAIR -1 on pDCs of juvenile systemic lupus erythematosus patients was significantly lower than that of control patients.
More...

AA Sequence

MSPHPTALLGLVLCLAQTIHTQEEDLPRPSISAEPGTVIPLGSHVTFVCRGPVGVQTFRLERESRSTYND      1 - 70
TEDVSQASPSESEARFRIDSVSEGNAGPYRCIYYKPPKWSEQSDYLELLVKETSGGPDSPDTEPGSSAGP     71 - 140
TQRPSDNSHNEHAPASQGLKAEHLYILIGVSVVFLFCLLLLVLFCLHRQNQIKQGPPRSKDEEQKPQQRP    141 - 210
DLAVDVLERTADKATVNGLPEKDRETDTSALAAGSSQEVTYAQLDHWALTQRTARAVSPQSTKPMAESIT    211 - 280
YAAVARH                                                                   281 - 287
//

Publication (59)

PMID Year Title
26721477 2016 Differential gene expression levels might explain association of LAIR2 polymorphisms with pemphigus.
26700814 2016 A LAIR1 insertion generates broadly reactive antibodies against malaria variant antigens.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25915125 2015 The ITIM-containing receptor LAIR1 is essential for acute myeloid leukaemia development.
25660999 2015 Leukocyte-associated immunoglobulin-like receptor-1 expressed in epithelial ovarian cancer cells and involved in cell proliferation and invasion.
25247291 2015 C1q-mediated repression of human monocytes is regulated by leukocyte-associated Ig-like receptor 1 (LAIR-1).
24750832 2014 [Expression of leukocyte-associated Ig-like receptor-1 in children with immune thrombocytopenia].
24585933 2014 Leukocyte-associated Ig-like receptor-1 is a novel inhibitory receptor for surfactant protein D.
24415628 2014 Clinical significance of LAIR1 (CD305) as assessed by flow cytometry in a prospective series of patients with chronic lymphocytic leukemia.
24399813 2014 Simultaneous changes in serum HMGB1 and IFN-? levels and in LAIR-1 expression on plasmatoid dendritic cells of patients with juvenile SLE. New therapeutic options?
More...