Property Summary

NCBI Gene PubMed Count 57
PubMed Score 64.21
PubTator Score 64.54

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (16)

Disease log2 FC p
adult high grade glioma 1.300 2.9e-03
astrocytoma 2.000 2.7e-02
Astrocytoma, Pilocytic 1.200 1.7e-05
chronic lymphosyte leukemia -1.100 5.7e-05
cutaneous lupus erythematosus 1.200 2.6e-03
glioblastoma 2.600 1.1e-03
head and neck cancer and chronic obstruc... 1.100 3.6e-04
interstitial cystitis 1.300 5.4e-03
invasive ductal carcinoma 1.377 1.9e-05
lung cancer -1.800 6.6e-04
lung carcinoma -2.100 1.5e-17
non-small cell lung cancer -1.455 2.2e-12
osteosarcoma -2.395 1.9e-04
subependymal giant cell astrocytoma 2.009 1.3e-02
tuberculosis and treatment for 3 months -1.200 1.3e-03
Waldenstrons macroglobulinemia -1.096 2.8e-03

Gene RIF (33)

AA Sequence

MSPHPTALLGLVLCLAQTIHTQEEDLPRPSISAEPGTVIPLGSHVTFVCRGPVGVQTFRLERESRSTYND      1 - 70
TEDVSQASPSESEARFRIDSVSEGNAGPYRCIYYKPPKWSEQSDYLELLVKETSGGPDSPDTEPGSSAGP     71 - 140
TQRPSDNSHNEHAPASQGLKAEHLYILIGVSVVFLFCLLLLVLFCLHRQNQIKQGPPRSKDEEQKPQQRP    141 - 210
DLAVDVLERTADKATVNGLPEKDRETDTSALAAGSSQEVTYAQLDHWALTQRTARAVSPQSTKPMAESIT    211 - 280
YAAVARH                                                                   281 - 287
//

Text Mined References (60)

PMID Year Title