Property Summary

NCBI Gene PubMed Count 9
PubMed Score 3.04
PubTator Score 2.60

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
psoriasis 6685 1.15716836977665E-19
intraductal papillary-mucinous adenoma (IPMA) 2956 6.11508644161472E-4
intraductal papillary-mucinous carcinoma (IPMC) 2988 9.07066671380173E-4
interstitial cystitis 2299 0.00161351096850195
pancreatic cancer 2300 0.0037992420553973
gastric carcinoma 832 0.0058320794563497
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.00988468156774867
primary pancreatic ductal adenocarcinoma 1271 0.0298255933879881
Disease Target Count Z-score Confidence
ADULT syndrome 9 3.38 1.7

Expression

Synonym

Accession Q6GTS8 Q6P4E3 Q96DM4
Symbols Cps1

Gene

PANTHER Protein Class (3)

  Ortholog (11)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA Inparanoid
Dog OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid
Chicken OMA EggNOG Inparanoid
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG Inparanoid
S.cerevisiae OMA EggNOG

Gene RIF (1)

PMID Text
18187620 Knockdown of peptidase M20 domain containing 1 (PM20D1; FLJ32569) by siRNA inhibits HIV-1 replication in HeLa-derived TZM-bl cells

AA Sequence

MAQRCVCVLALVAMLLLVFPTVSRSMGPRSGEHQRASRIPSQFSKEERVAMKEALKGAIQIPTVTFSSEK      1 - 70
SNTTALAEFGKYIHKVFPTVVSTSFIQHEVVEEYSHLFTIQGSDPSLQPYLLMAHFDVVPAPEEGWEVPP     71 - 140
FSGLERDGIIYGRGTLDDKNSVMALLQALELLLIRKYIPRRSFFISLGHDEESSGTGAQRISALLQSRGV    141 - 210
QLAFIVDEGGFILDDFIPNFKKPIALIAVSEKGSMNLMLQVNMTSGHSSAPPKETSIGILAAAVSRLEQT    211 - 280
PMPIIFGSGTVVTVLQQLANEFPFPVNIILSNPWLFEPLISRFMERNPLTNAIIRTTTALTIFKAGVKFN    281 - 350
VIPPVAQATVNFRIHPGQTVQEVLELTKNIVADNRVQFHVLSAFDPLPVSPSDDKALGYQLLRQTVQSVF    351 - 420
PEVNITAPVTSIGNTDSRFFTNLTTGIYRFYPIYIQPEDFKRIHGVNEKISVQAYETQVKFIFELIQNAD    421 - 490
TDQEPVSHLHKL                                                              491 - 502
//

Text Mined References (11)

PMID Year Title
27374330 2016 The Secreted Enzyme PM20D1 Regulates Lipidated Amino Acid Uncouplers of Mitochondria.
23269536 2013 Genome-wide association study identified novel genetic variant on SLC45A3 gene associated with serum levels prostate-specific antigen (PSA) in a Chinese population.
21840748 2011 An association between the PARK16 locus and Parkinson's disease in a cohort from eastern China.
19915576 2009 Genome-wide association study identifies common variants at four loci as genetic risk factors for Parkinson's disease.
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
18187620 2008 Identification of host proteins required for HIV infection through a functional genomic screen.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
More...