Property Summary

NCBI Gene PubMed Count 28
PubMed Score 35.63
PubTator Score 13.81

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count
Schizophrenia 503
Disease Target Count P-value
osteosarcoma 7933 3.13248787413602E-5
ovarian cancer 8492 6.83231324155262E-5
intraductal papillary-mucinous adenoma (IPMA) 2956 0.00121323427012954
medulloblastoma, large-cell 6234 0.00145307422453611
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.00491629861418524
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.020838502720008
spina bifida 1064 0.0345855386838441
Breast cancer 3099 0.0392857279244993

Synonym

Accession Q6GQQ9 B7Z643 D3DUZ8 Q5SZ60 Q8WWA7 Q9NQ53 Q9UFF4
Symbols ZA20D1
CEZANNE

Gene

  Ortholog (8)

Species Source
Macaque OMA Inparanoid
Mouse OMA Inparanoid
Rat OMA Inparanoid
Dog OMA Inparanoid
Cow OMA Inparanoid
Opossum OMA Inparanoid
Chicken OMA Inparanoid
Xenopus OMA Inparanoid

Gene RIF (13)

PMID Text
26148512 these data reveal a novel mechanism for the regulation of the expression of HIF2a, demonstrating that the HIF2a promoter is regulated by E2F1 directly and that Cezanne regulates HIF2a expression through control of E2F1 levels
26112491 Taken together, these results suggest that hepatitis C virus NS5A protein interacts with OTUD7B, thereby modulating its deubiquitinase activity.
25638165 Cezanne has a pivotal role in tumor progression and prognosis, and may act as a potential prognostic biomarker for survival in hepatocellular carcinoma patients.
25355043 data suggest that Cezanne is essential for HIF-1alpha protein stability and that loss of Cezanne stimulates HIF-1alpha degradation via proteasome-independent routes, possibly through chaperone-mediated autophagy.
25353672 Genome wide association study shows evidence of association between mammographic density and SNPs in high linkage disequilibrium with rs11205277, rs11205303 in gene MTMR11 and rs67807996 in gene OTUD7B.
23564640 Inflammatory responses to ischemia are controlled by a balance between TRAF6 ubiquitination and deubiquitination, and Cezanne is a key regulator of this process.
22179831 identified a deubiquitinating enzyme, Cezanne-1, that opposes receptor degradation and enhances EGFR signaling
21624200 There is an excessive inflammatory response but insufficient up-regulation of A20 expression in inflammatory bowel disease patients.
21097510 DJ-1 enhances cell survival through the binding of Cezanne, a negative regulator of NF-kappaB.
20622874 Cezanne is identified as the first deubiquitinase with Lys11-linkage preference.
More...

AA Sequence

MTLDMDAVLSDFVRSTGAEPGLARDLLEGKNWDVNAALSDFEQLRQVHAGNLPPSFSEGSGGSRTPEKGF      1 - 70
SDREPTRPPRPILQRQDDIVQEKRLSRGISHASSSIVSLARSHVSSNGGGGGSNEHPLEMPICAFQLPDL     71 - 140
TVYNEDFRSFIERDLIEQSMLVALEQAGRLNWWVSVDPTSQRLLPLATTGDGNCLLHAASLGMWGFHDRD    141 - 210
LMLRKALYALMEKGVEKEALKRRWRWQQTQQNKESGLVYTEDEWQKEWNELIKLASSEPRMHLGTNGANC    211 - 280
GGVESSEEPVYESLEEFHVFVLAHVLRRPIVVVADTMLRDSGGEAFAPIPFGGIYLPLEVPASQCHRSPL    281 - 350
VLAYDQAHFSALVSMEQKENTKEQAVIPLTDSEYKLLPLHFAVDPGKGWEWGKDDSDNVRLASVILSLEV    351 - 420
KLHLLHSYMNVKWIPLSSDAQAPLAQPESPTASAGDEPRSTPESGDSDKESVGSSSTSNEGGRRKEKSKR    421 - 490
DREKDKKRADSVANKLGSFGKTLGSKLKKNMGGLMHSKGSKPGGVGTGLGGSSGTETLEKKKKNSLKSWK    491 - 560
GGKEEAAGDGPVSEKPPAESVGNGGSKYSQEVMQSLSILRTAMQGEGKFIFVGTLKMGHRHQYQEEMIQR    561 - 630
YLSDAEERFLAEQKQKEAERKIMNGGIGGGPPPAKKPEPDAREEQPTGPPAESRAMAFSTGYPGDFTIPR    631 - 700
PSGGGVHCQEPRRQLAGGPCVGGLPPYATFPRQCPPGRPYPHQDSIPSLEPGSHSKDGLHRGALLPPPYR    701 - 770
VADSYSNGYREPPEPDGWAGGLRGLPPTQTKCKQPNCSFYGHPETNNFCSCCYREELRRREREPDGELLV    771 - 840
HRF                                                                       841 - 843
//

Text Mined References (41)

PMID Year Title
26148512 2015 Cezanne regulates E2F1-dependent HIF2? expression.
26112491 2015 Physical and functional interaction between hepatitis C virus NS5A protein and ovarian tumor protein deubiquitinase 7B.
25814554 2015 Phospho-tyrosine dependent protein-protein interaction network.
25638165 2015 Decreased Cezanne expression is associated with the progression and poor prognosis in hepatocellular carcinoma.
25355043 2014 Cezanne (OTUD7B) regulates HIF-1? homeostasis in a proteasome-independent manner.
25353672 2015 Genome wide association study identifies a novel putative mammographic density locus at 1q12-q21.
25056061 2014 Biological insights from 108 schizophrenia-associated genetic loci.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23827681 2013 OTU deubiquitinases reveal mechanisms of linkage specificity and enable ubiquitin chain restriction analysis.
23564640 2013 Cezanne regulates inflammatory responses to hypoxia in endothelial cells by targeting TRAF6 for deubiquitination.
More...